(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0535

BA000037.VV0535      Location/Qualifiers
FT   CDS             complement(523603..524544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0535"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93299"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93299"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP29"
FT                   /protein_id="BAC93299.1"
FT                   /translation="MKNTTRLAALLSASATILCSPALARTWVEVGTEYEQYFDETDQGA
FT                   TYNYERLNAYTPYVRFSHSPTNNEWNIWGRAFKKYYTNEELFPNGEVNAQVDRLELHYT
FT                   QMNRKGAWRFRPGVGVRYNGYDIDRYETEYRLYPQFDYFFNSNSQAFLSGHWYIGDSKG
FT                   IRMGDTQPQNYTDWGYEAEFGWLYRFANGSSIKPHFYTEYDSYENNFDIDYWQFRLVYS
FT                   QKIGRATINPFIRYGLGRDITDRSHSDPERWGLKRDNNYSRAGVFGNVGISGKWNLIYE
FT                   TYYQVEDQHGTWGEELPDRDKFFAKFGIQRIF"
     MKNTTRLAAL LSASATILCS PALARTWVEV GTEYEQYFDE TDQGATYNYE RLNAYTPYVR        60
     FSHSPTNNEW NIWGRAFKKY YTNEELFPNG EVNAQVDRLE LHYTQMNRKG AWRFRPGVGV       120
     RYNGYDIDRY ETEYRLYPQF DYFFNSNSQA FLSGHWYIGD SKGIRMGDTQ PQNYTDWGYE       180
     AEFGWLYRFA NGSSIKPHFY TEYDSYENNF DIDYWQFRLV YSQKIGRATI NPFIRYGLGR       240
     DITDRSHSDP ERWGLKRDNN YSRAGVFGNV GISGKWNLIY ETYYQVEDQH GTWGEELPDR       300
     DKFFAKFGIQ RIF                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page