(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0544

BA000037.VV0544      Location/Qualifiers
FT   CDS             531291..532778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93308"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93308"
FT                   /db_xref="InterPro:IPR016624"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP20"
FT                   /protein_id="BAC93308.1"
FT                   /translation="MTKFIQASERPYIPCEHPDLNQYLQLFKQNLIRCKLKRRGFVDLD
FT                   EQIIAVFKQNTELKVQCEALVDYVAEAFEHYAVWDYSHAYYPGVSSQQTARLDAMEGSS
FT                   RVLPTLAAWLHANPNTALKSSTLSEAQFNLVDWIKCAFLAGTNPHHSGYWGNIEDYDQR
FT                   ICESADLALALWLSKEQVWQTLASDEQQQIVTWFTQVNHVETVDNNWHLFPLTVQLVMK
FT                   DLTGEDHVEHHRYARVKEFFVGDGWFRDGAKGNYDYYNAWGFHYSLYWLAQIDPEFDPH
FT                   FIRHSLRTFSDKYRYFFTPQGFPLFGRSACYRLSATAPLIATLDVCGANLPNEYLGQFK
FT                   RAFKTNLCYFISNGALQKGRPTQGLFADDIRLTDNYSGPASSFWSLRALNIALFCGDRI
FT                   GLWEAKEQPLEIEKESFMFSLNGPNMLVVGIQETQEVNVIFKNDYIKEQTPQSRKLASQ
FT                   SILKKWQERLVGRAERPKNNLLRKGVTSYSSKLFHFF"
     MTKFIQASER PYIPCEHPDL NQYLQLFKQN LIRCKLKRRG FVDLDEQIIA VFKQNTELKV        60
     QCEALVDYVA EAFEHYAVWD YSHAYYPGVS SQQTARLDAM EGSSRVLPTL AAWLHANPNT       120
     ALKSSTLSEA QFNLVDWIKC AFLAGTNPHH SGYWGNIEDY DQRICESADL ALALWLSKEQ       180
     VWQTLASDEQ QQIVTWFTQV NHVETVDNNW HLFPLTVQLV MKDLTGEDHV EHHRYARVKE       240
     FFVGDGWFRD GAKGNYDYYN AWGFHYSLYW LAQIDPEFDP HFIRHSLRTF SDKYRYFFTP       300
     QGFPLFGRSA CYRLSATAPL IATLDVCGAN LPNEYLGQFK RAFKTNLCYF ISNGALQKGR       360
     PTQGLFADDI RLTDNYSGPA SSFWSLRALN IALFCGDRIG LWEAKEQPLE IEKESFMFSL       420
     NGPNMLVVGI QETQEVNVIF KNDYIKEQTP QSRKLASQSI LKKWQERLVG RAERPKNNLL       480
     RKGVTSYSSK LFHFF                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page