(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0547

BA000037.VV0547      Location/Qualifiers
FT   CDS             534147..534305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0547"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93311"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93311"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP17"
FT                   /protein_id="BAC93311.1"
FT                   /translation="MISTEFRVQRWNVRIDNPTVEQAFVFVAPLRTASSTSVTILSRSE
FT                   IGISLPR"
     MISTEFRVQR WNVRIDNPTV EQAFVFVAPL RTASSTSVTI LSRSEIGISL PR                52
//

If you have problems or comments...

PBIL Back to PBIL home page