(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0549

BA000037.VV0549      Location/Qualifiers
FT   CDS             534852..535229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0549"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93313"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93313"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP15"
FT                   /protein_id="BAC93313.1"
FT                   /translation="MTDRNAPKYALFTQKTCYELLNQQLKRLNKLKSSLLLVLERPEIP
FT                   IHTNGSENDLREQVKRRKVSGGTRSDLGRQCRDTFSSLKKTYQKLDVSFWEYLNDRISQ
FT                   SNIIPTLGSLVLQKAHLASTY"
     MTDRNAPKYA LFTQKTCYEL LNQQLKRLNK LKSSLLLVLE RPEIPIHTNG SENDLREQVK        60
     RRKVSGGTRS DLGRQCRDTF SSLKKTYQKL DVSFWEYLND RISQSNIIPT LGSLVLQKAH       120
     LASTY                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page