(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0554

BA000037.VV0554      Location/Qualifiers
FT   CDS             537766..538698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0554"
FT                   /product="sugar kinase"
FT                   /note="ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93318"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93318"
FT                   /db_xref="GOA:Q7MP10"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MP10"
FT                   /protein_id="BAC93318.1"
FT                   /translation="MNHIKRVAVIGECMVELRRNNGVLEQGFGGDTLNTAVYLSRLTHE
FT                   HGVASSYVTGLGRDAFSQQMLSAWQVEALDTEHVFISEDKLPGIYVIETAADGERSFFY
FT                   WRNDSAAKYWLRGQEIPQLAHALRHHQMIYLSGISLAILPSDCCDALLELLRLLRAQGA
FT                   TIAFDNNYRPALWPSQQQAQSVYRQVLALTDIAFLTFDDEQALYGDETEQQAVDRTQTL
FT                   GVKEIVIKRGAEPCMVVTQVGIESIASQPVEKIVDTTAAGDSFSAGYLAKRLLGGSTGE
FT                   SALAGHTLAGAVIQQRGALIGTDAMPTII"
     MNHIKRVAVI GECMVELRRN NGVLEQGFGG DTLNTAVYLS RLTHEHGVAS SYVTGLGRDA        60
     FSQQMLSAWQ VEALDTEHVF ISEDKLPGIY VIETAADGER SFFYWRNDSA AKYWLRGQEI       120
     PQLAHALRHH QMIYLSGISL AILPSDCCDA LLELLRLLRA QGATIAFDNN YRPALWPSQQ       180
     QAQSVYRQVL ALTDIAFLTF DDEQALYGDE TEQQAVDRTQ TLGVKEIVIK RGAEPCMVVT       240
     QVGIESIASQ PVEKIVDTTA AGDSFSAGYL AKRLLGGSTG ESALAGHTLA GAVIQQRGAL       300
     IGTDAMPTII                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page