(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0564

BA000037.VV0564      Location/Qualifiers
FT   CDS             complement(546821..547036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0564"
FT                   /product="ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93328"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93328"
FT                   /db_xref="GOA:Q7MP00"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MP00"
FT                   /protein_id="BAC93328.1"
FT                   /translation="MPVVKVRENEPFDVALRRFKRSCEKAGILSEVRRREHYEKPTTVR
FT                   KRAKAAAQKRHAKKLARENARRVRLY"
     MPVVKVRENE PFDVALRRFK RSCEKAGILS EVRRREHYEK PTTVRKRAKA AAQKRHAKKL        60
     ARENARRVRL Y                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page