(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0570

BA000037.VV0570      Location/Qualifiers
FT   CDS             550903..551706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0570"
FT                   /product="putative undecaprenol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93334"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93334"
FT                   /db_xref="GOA:Q7MNZ4"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNZ4"
FT                   /protein_id="BAC93334.1"
FT                   /translation="MSYFEAFVLALIQGLTEFLPISSSAHLILPSAILGWEDQGLAFDV
FT                   AVHVGTLAAVVIYFRKEVITLFAALFASIFKGERSKEAKLAWMIVIATIPACIFGLVMK
FT                   DVIEVYLRSAYVIATTTIIFGLLLWWVDKNASLLDDEYQAGWKKALFIGIAQALAMIPG
FT                   TSRSGATITAALYLGFTREAAARFSFLMSIPIITLAGSYLGLKLVTSGEPVHVGFLLTG
FT                   IVTSFISAYLCIHLFLKMISRMGMTPFVIYRLILGVGLFAYLLMA"
     MSYFEAFVLA LIQGLTEFLP ISSSAHLILP SAILGWEDQG LAFDVAVHVG TLAAVVIYFR        60
     KEVITLFAAL FASIFKGERS KEAKLAWMIV IATIPACIFG LVMKDVIEVY LRSAYVIATT       120
     TIIFGLLLWW VDKNASLLDD EYQAGWKKAL FIGIAQALAM IPGTSRSGAT ITAALYLGFT       180
     REAAARFSFL MSIPIITLAG SYLGLKLVTS GEPVHVGFLL TGIVTSFISA YLCIHLFLKM       240
     ISRMGMTPFV IYRLILGVGL FAYLLMA                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page