(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0572

BA000037.VV0572      Location/Qualifiers
FT   CDS             553092..555248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0572"
FT                   /product="putative general secretion pathway protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93336"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93336"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032389"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNZ3"
FT                   /protein_id="BAC93336.1"
FT                   /translation="MYKDFFGFSELPFSIVPNSRYLYLSQRHREAITHLQAGLGDGGGF
FT                   AMLTGEVGTGKTTVAKSMLANLDGQTCAALLLNPTFSSVELLEAICDEFGLSYAANASL
FT                   KQLNQRIYQFLLENHQQNIQTLLVIDEAQHLAADVLEQLRLLTNLETETRKLLKVLLVG
FT                   QPELQQLLQTTQLRQLAQRITGRYHLLPLNPQETADYIAFRIHTAGGNRTLFDHASAKV
FT                   IAQYSHGIPRLINLICDKALQLSYHQGDKKITKATVERACQNVMAFQAEIYQQTSNRSS
FT                   FPWGKVSVVAACVAGVLAIASYWPLIPTDNVVPTVPPVERDKPATELPILPSVPDILVN
FT                   DEQWLGESAVARMTTRAQGLEDLYKLWGYRATRIDTLCEQPSTSIFQCQVRQLNWQELQ
FT                   QTPHPLLLTLQHEGQRAYVVLLEVNSERVVLLTGEQRLTFTVPQLMSLWRGEVTDLWPM
FT                   PLRETLRLGMHGEAIAVLDQLLAKALNDEPLKTTQFNAELMQRVEWFQRWQAMTEDGIA
FT                   GQRTLARLQHMVSLSEPWRDFTKAEKQGEEQAMRYPEFPSLAPLPRTYPLAETGDAINV
FT                   ADQTSPTLVASPSIPSEEKKTADERLFENLDLSGLSPELAQKVENALLVETQTDHSPQT
FT                   ESTVSRLDLSAEKWHGRLPPLNLQTHMYSSDPKRRWLKINGAEFHQGEWIDNQIQLVEI
FT                   SAQSVIVEFQGEQIEIPALYEWKG"
     MYKDFFGFSE LPFSIVPNSR YLYLSQRHRE AITHLQAGLG DGGGFAMLTG EVGTGKTTVA        60
     KSMLANLDGQ TCAALLLNPT FSSVELLEAI CDEFGLSYAA NASLKQLNQR IYQFLLENHQ       120
     QNIQTLLVID EAQHLAADVL EQLRLLTNLE TETRKLLKVL LVGQPELQQL LQTTQLRQLA       180
     QRITGRYHLL PLNPQETADY IAFRIHTAGG NRTLFDHASA KVIAQYSHGI PRLINLICDK       240
     ALQLSYHQGD KKITKATVER ACQNVMAFQA EIYQQTSNRS SFPWGKVSVV AACVAGVLAI       300
     ASYWPLIPTD NVVPTVPPVE RDKPATELPI LPSVPDILVN DEQWLGESAV ARMTTRAQGL       360
     EDLYKLWGYR ATRIDTLCEQ PSTSIFQCQV RQLNWQELQQ TPHPLLLTLQ HEGQRAYVVL       420
     LEVNSERVVL LTGEQRLTFT VPQLMSLWRG EVTDLWPMPL RETLRLGMHG EAIAVLDQLL       480
     AKALNDEPLK TTQFNAELMQ RVEWFQRWQA MTEDGIAGQR TLARLQHMVS LSEPWRDFTK       540
     AEKQGEEQAM RYPEFPSLAP LPRTYPLAET GDAINVADQT SPTLVASPSI PSEEKKTADE       600
     RLFENLDLSG LSPELAQKVE NALLVETQTD HSPQTESTVS RLDLSAEKWH GRLPPLNLQT       660
     HMYSSDPKRR WLKINGAEFH QGEWIDNQIQ LVEISAQSVI VEFQGEQIEI PALYEWKG         718
//

If you have problems or comments...

PBIL Back to PBIL home page