(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0573

BA000037.VV0573      Location/Qualifiers
FT   CDS             complement(555322..555933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0573"
FT                   /product="SH3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93337"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93337"
FT                   /db_xref="GOA:Q7MNZ2"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR016476"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNZ2"
FT                   /protein_id="BAC93337.1"
FT                   /translation="MKKLIVTVLLTLLAVPSVFAQDRYIADELFTYMHSGPNNTFRIIG
FT                   SVDAGSKVKLLQTNSETGYSEVVDERGRKGWVQAKFITRQESMAVRLPRLEKELKEVKS
FT                   QLANARQNADTEKAGLVDSLDTRNQQISDLEKKYSEISDQLASVQTENRQLRAKLDTQK
FT                   DDLLLKYFMYGGGVAGIGLLFGLILPYMIPRRKKSNSGWA"
     MKKLIVTVLL TLLAVPSVFA QDRYIADELF TYMHSGPNNT FRIIGSVDAG SKVKLLQTNS        60
     ETGYSEVVDE RGRKGWVQAK FITRQESMAV RLPRLEKELK EVKSQLANAR QNADTEKAGL       120
     VDSLDTRNQQ ISDLEKKYSE ISDQLASVQT ENRQLRAKLD TQKDDLLLKY FMYGGGVAGI       180
     GLLFGLILPY MIPRRKKSNS GWA                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page