(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0585

BA000037.VV0585      Location/Qualifiers
FT   CDS             568814..569266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0585"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93349"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93349"
FT                   /db_xref="InterPro:IPR009659"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNY0"
FT                   /protein_id="BAC93349.1"
FT                   /translation="MMGLAAAKQPYYVDLAGLMRTYETNYAKLNALLPFNAEVGDVRCY
FT                   QVVNMIYQMTVKEVTKYTTIVEICQSDDIPLFPLPTMSVRLYHDARVAEVLSSGEHVRF
FT                   KAKYDYPNEKLMQKDEKHQLNAFLGEWLTFCLKSGISRTPITFKEE"
     MMGLAAAKQP YYVDLAGLMR TYETNYAKLN ALLPFNAEVG DVRCYQVVNM IYQMTVKEVT        60
     KYTTIVEICQ SDDIPLFPLP TMSVRLYHDA RVAEVLSSGE HVRFKAKYDY PNEKLMQKDE       120
     KHQLNAFLGE WLTFCLKSGI SRTPITFKEE                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page