(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0596

BA000037.VV0596      Location/Qualifiers
FT   CDS             581037..581627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0596"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93360"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93360"
FT                   /db_xref="GOA:Q7MNW9"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNW9"
FT                   /protein_id="BAC93360.1"
FT                   /translation="MSNAPLNNGRRRFLTATTAVVGGLGAAAVAVPFIKSWNPSAKAKA
FT                   AGAPVEVDVSKIEAGQMIRVEWQGKPVWVVRRTQEVIDNLKTIGGQLRDPQSEMEQQPT
FT                   YAQNEFRSIKPEFFVAVGFCTHLGCSPTYLPDSFAEQVQGVKSGFFCPCHGSKFDMAGR
FT                   VFQGVPAPLNLVVPKHMYLSDTTILIGVDEGDA"
     MSNAPLNNGR RRFLTATTAV VGGLGAAAVA VPFIKSWNPS AKAKAAGAPV EVDVSKIEAG        60
     QMIRVEWQGK PVWVVRRTQE VIDNLKTIGG QLRDPQSEME QQPTYAQNEF RSIKPEFFVA       120
     VGFCTHLGCS PTYLPDSFAE QVQGVKSGFF CPCHGSKFDM AGRVFQGVPA PLNLVVPKHM       180
     YLSDTTILIG VDEGDA                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page