(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0608

BA000037.VV0608      Location/Qualifiers
FT   CDS             591202..592932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0608"
FT                   /product="cell division protein FtsI"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93372"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93372"
FT                   /db_xref="GOA:Q7MNV7"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNV7"
FT                   /protein_id="BAC93372.1"
FT                   /translation="MMGKKSKTTVKPKESEQGTSLLIRWRFHLVLGFVFLAFAALVVRL
FT                   AFIQVIEPDNLIREGDLRSIRVKALPSARGIISDRNGEPLAVSVPVEAVWADPVTIFKE
FT                   KALDNKQRWYALADVLGLQREELIERIERNENRRFIYLQRQVSPAMANYIRELKIPGVG
FT                   LKSESRRYYPAGEVSAHLVGVTGIDGHGLEGVERSYDNWLTGEAGKQTIRKDRYGRVVE
FT                   NIAYEDRQEGKSLELTIDQRLQAIAYRAIKQAVADHRATSGSAVMLDVKTGAVLAMVNA
FT                   PSYNPNNRSDWQSYKMRNRIITDSLEPGSTVKPFVILAALENGVATKDTVIDTGNGILQ
FT                   VGGSRVRDTSKVGKADLTEILKKSSNIGVTKLSMEMPVEAILGMYNSVGLGEPSGLNLV
FT                   GEVTGIFPTRSRWSPIERATLSFGYGLSITPIQLAHAYATLGNEGMYEPIHIIKSNDRD
FT                   MAKQVVSKQHAREVLNMLETVTQKGGSARRAAVPGYRVGAKTGTSRKATAGGYSDEYIT
FT                   YTAGVAPVSDPRIALVVVVNEPQGDDYYGGSVASPVFSEIMKGALQILNVAPDENAFQN
FT                   "
     MMGKKSKTTV KPKESEQGTS LLIRWRFHLV LGFVFLAFAA LVVRLAFIQV IEPDNLIREG        60
     DLRSIRVKAL PSARGIISDR NGEPLAVSVP VEAVWADPVT IFKEKALDNK QRWYALADVL       120
     GLQREELIER IERNENRRFI YLQRQVSPAM ANYIRELKIP GVGLKSESRR YYPAGEVSAH       180
     LVGVTGIDGH GLEGVERSYD NWLTGEAGKQ TIRKDRYGRV VENIAYEDRQ EGKSLELTID       240
     QRLQAIAYRA IKQAVADHRA TSGSAVMLDV KTGAVLAMVN APSYNPNNRS DWQSYKMRNR       300
     IITDSLEPGS TVKPFVILAA LENGVATKDT VIDTGNGILQ VGGSRVRDTS KVGKADLTEI       360
     LKKSSNIGVT KLSMEMPVEA ILGMYNSVGL GEPSGLNLVG EVTGIFPTRS RWSPIERATL       420
     SFGYGLSITP IQLAHAYATL GNEGMYEPIH IIKSNDRDMA KQVVSKQHAR EVLNMLETVT       480
     QKGGSARRAA VPGYRVGAKT GTSRKATAGG YSDEYITYTA GVAPVSDPRI ALVVVVNEPQ       540
     GDDYYGGSVA SPVFSEIMKG ALQILNVAPD ENAFQN                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page