(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0617

BA000037.VV0617      Location/Qualifiers
FT   CDS             602905..604242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0617"
FT                   /product="cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93381"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93381"
FT                   /db_xref="GOA:Q7MNU8"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNU8"
FT                   /protein_id="BAC93381.1"
FT                   /translation="MLTSGMTREPLLAGSLSKSQNKRVQMTKTADDNIIVGLDIGTATV
FT                   SALVGEILPDGQINIIGAGSSPSRGMDKGGVNDLESVVKSVQRAIDQAEMMAECQISNV
FT                   FISLSGKHIASRIEKGMGTISDEEVSQEDMDRAIHTAKSIKIGDEQRILHVIPQEFTID
FT                   YQEGIKNPLGLSGVRMEVSVHLISCHNDMARNIIKAVERCGLKVEQIVFSGLAASNAVI
FT                   TEDERELGVCVVDIGAGTMDVAIWTGGALRHTEVFSYAGNAVTSDIAFAFGTPVSDAEE
FT                   IKVKYGCALSELVSKDDTVNVPSVGGRPSRSLQRQTLSEVIEPRYSELMGLVNQTIESV
FT                   QMKLREDGIKHHLAAGVVLTGGAAQIEGLVECAERVFRNQVRVGKPLEVSGLTDYVKEP
FT                   YHSTAVGLLHYARDMRSSDDSDYNEPKRSAVTGLFGKLRNWIQKEF"
     MLTSGMTREP LLAGSLSKSQ NKRVQMTKTA DDNIIVGLDI GTATVSALVG EILPDGQINI        60
     IGAGSSPSRG MDKGGVNDLE SVVKSVQRAI DQAEMMAECQ ISNVFISLSG KHIASRIEKG       120
     MGTISDEEVS QEDMDRAIHT AKSIKIGDEQ RILHVIPQEF TIDYQEGIKN PLGLSGVRME       180
     VSVHLISCHN DMARNIIKAV ERCGLKVEQI VFSGLAASNA VITEDERELG VCVVDIGAGT       240
     MDVAIWTGGA LRHTEVFSYA GNAVTSDIAF AFGTPVSDAE EIKVKYGCAL SELVSKDDTV       300
     NVPSVGGRPS RSLQRQTLSE VIEPRYSELM GLVNQTIESV QMKLREDGIK HHLAAGVVLT       360
     GGAAQIEGLV ECAERVFRNQ VRVGKPLEVS GLTDYVKEPY HSTAVGLLHY ARDMRSSDDS       420
     DYNEPKRSAV TGLFGKLRNW IQKEF                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page