(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0624

BA000037.VV0624      Location/Qualifiers
FT   CDS             611941..613080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0624"
FT                   /product="carbamoylphosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93388"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93388"
FT                   /db_xref="GOA:Q7MNU1"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNU1"
FT                   /protein_id="BAC93388.1"
FT                   /translation="MSKSALLVLEDGTVFRGVSIGADGISVGEVVFNTSMTGYQEILTD
FT                   PSYSQQIVTLTYPHIGNTGTTSEDEESSSIHAQGLVIRDLPLIASNFRSEQSLSDYLKS
FT                   QNIVGIADIDTRKLTRILREKGAQNGCIVAGNNLDEALALAKAKEFPGLKGMDLAKEVT
FT                   TKEAYQWKQGSWTLEGGLPEAKDDSELPYHVVAYDFGAKRNILRMLVDRGCRLTVVPAE
FT                   TSAEDVLALNPDGVFLSNGPGDPAPCTYAIEATKVFLEKGLPVFGICLGHQILALASGA
FT                   KTVKMKFGHHGANHPVKDLDRNVVMITSQNHGFAADEATLPDNLRATHVSLFDGSLQGI
FT                   HRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIKQHSA"
     MSKSALLVLE DGTVFRGVSI GADGISVGEV VFNTSMTGYQ EILTDPSYSQ QIVTLTYPHI        60
     GNTGTTSEDE ESSSIHAQGL VIRDLPLIAS NFRSEQSLSD YLKSQNIVGI ADIDTRKLTR       120
     ILREKGAQNG CIVAGNNLDE ALALAKAKEF PGLKGMDLAK EVTTKEAYQW KQGSWTLEGG       180
     LPEAKDDSEL PYHVVAYDFG AKRNILRMLV DRGCRLTVVP AETSAEDVLA LNPDGVFLSN       240
     GPGDPAPCTY AIEATKVFLE KGLPVFGICL GHQILALASG AKTVKMKFGH HGANHPVKDL       300
     DRNVVMITSQ NHGFAADEAT LPDNLRATHV SLFDGSLQGI HRTDKPAFSF QGHPEASPGP       360
     HDAAPLFDHF IELIKQHSA                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page