(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0636

BA000037.VV0636      Location/Qualifiers
FT   CDS             complement(622850..623278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0636"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93400"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93400"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNS9"
FT                   /protein_id="BAC93400.1"
FT                   /translation="MKKLILTICATLALTACSNGAYTMTDRTSQPCGNKPNCVSTQDER
FT                   ASFQLDPFKLTSNATLDQIEQVALELPGAKVADKKEHYLRVECTSRLFRFVDDLELKIV
FT                   DGQLLVRSESRVGYSDLGVNRKRAEQLRSLLTEAGFIK"
     MKKLILTICA TLALTACSNG AYTMTDRTSQ PCGNKPNCVS TQDERASFQL DPFKLTSNAT        60
     LDQIEQVALE LPGAKVADKK EHYLRVECTS RLFRFVDDLE LKIVDGQLLV RSESRVGYSD       120
     LGVNRKRAEQ LRSLLTEAGF IK                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page