(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0640

BA000037.VV0640      Location/Qualifiers
FT   CDS             complement(629715..631184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0640"
FT                   /product="NADPH-dependent glutamate synthase, small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93404"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93404"
FT                   /db_xref="GOA:Q7MNS5"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNS5"
FT                   /protein_id="BAC93404.1"
FT                   /translation="MGKPTGFLEFGRELPKKLAPAERIKNNKEFVLNAEFGKKINTQAS
FT                   RCMDCGVPFCHNGCPIGNIIPEFNDAVYRDSWEEAWNILSSTNNFPEFTGRVCPAPCES
FT                   ACVLGINQDPITICNIEKTIVETAYREGYAKPKTPRSRTGKKVAIIGSGPAGLAAAEQL
FT                   NSAGHSVTVFERDEKVGGLLRFGIPDFKLGMDIIDRKINLMAEAGVEFKVNQHVGVDVN
FT                   AQQIRQEYDVVLLTGGSTVPRDLPVPGRELKGVYFAMQFLAQNNRRANEMDLKGEEIHA
FT                   AGKHVVVIGGGDTGSDCVGTSNRHGAASVTQVEIMPVPPEKRPANMPWPQYPMILRTST
FT                   SHEEGVDRHWNILTKEFIGNDKGEVTGLRLADIVWQDAQPGERPSFKEVEGSERVIPCD
FT                   MAFLAMGFLHPEPHGVLAQLNVALDERGNVATQDFQTNQQGVFAAGDMRTGQSLVVRCI
FT                   NEGRECARAIDQYLMGNTNLEAKADSLMLSA"
     MGKPTGFLEF GRELPKKLAP AERIKNNKEF VLNAEFGKKI NTQASRCMDC GVPFCHNGCP        60
     IGNIIPEFND AVYRDSWEEA WNILSSTNNF PEFTGRVCPA PCESACVLGI NQDPITICNI       120
     EKTIVETAYR EGYAKPKTPR SRTGKKVAII GSGPAGLAAA EQLNSAGHSV TVFERDEKVG       180
     GLLRFGIPDF KLGMDIIDRK INLMAEAGVE FKVNQHVGVD VNAQQIRQEY DVVLLTGGST       240
     VPRDLPVPGR ELKGVYFAMQ FLAQNNRRAN EMDLKGEEIH AAGKHVVVIG GGDTGSDCVG       300
     TSNRHGAASV TQVEIMPVPP EKRPANMPWP QYPMILRTST SHEEGVDRHW NILTKEFIGN       360
     DKGEVTGLRL ADIVWQDAQP GERPSFKEVE GSERVIPCDM AFLAMGFLHP EPHGVLAQLN       420
     VALDERGNVA TQDFQTNQQG VFAAGDMRTG QSLVVRCINE GRECARAIDQ YLMGNTNLEA       480
     KADSLMLSA                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page