(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0643

BA000037.VV0643      Location/Qualifiers
FT   CDS             637264..639069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0643"
FT                   /product="sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93407"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93407"
FT                   /db_xref="GOA:Q7MNS2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNS2"
FT                   /protein_id="BAC93407.1"
FT                   /translation="MRMDKQFAWIAHLAEHYGAIILMAVFGYVVVRLLHLRYQRELDTL
FT                   ILDLMSPVLLVDLSGQHVLLANSAAMQQLGVRQLNRTYLFPATFAIEQLSNSLTSLSGR
FT                   QFSQLAFAWQASEHEHLDVALSGRKVYYRGQHCWLLNIQLNPSNRSRHMDDLDAFLVAQ
FT                   SALDSLSELICLKDNDGKILATNRAFELFWEGRRDEAIMPESRLMKGRQSERRWTTDPQ
FT                   GRSCLLEVNQSLLMTKAGEPIGTLSISHDVTEWHAMQQNLRDEMERRKDTEVALAQRDT
FT                   ILQNILEASPDSIGIFNENLVYQACNEPFVRALGIADVNDLIGKRLQDVVPGEMYQRLS
FT                   VTDSQVLHEGKSLRYIDKVLDSNGEYAWYDVVKSPFRDPASGTNGVLIMARDISERYLA
FT                   EQKLEAANLELEKLSFMDSLTQVSNRRRFDEQLNTLWFHHAREKLPLTIMLCDIDFFKE
FT                   FNDRYGHQAGDEALIQVATVFSQVVSRSSDCVARYGGEEFALLLPNTTAEGALKVAEKI
FT                   HAYIAESNIAHQGSKIAGRVTISIGLVSYIPSPEDVPDMGVALADSALYQAKSDGRNRT
FT                   CVHPISLSSGESPSTLAQGNPPYAN"
     MRMDKQFAWI AHLAEHYGAI ILMAVFGYVV VRLLHLRYQR ELDTLILDLM SPVLLVDLSG        60
     QHVLLANSAA MQQLGVRQLN RTYLFPATFA IEQLSNSLTS LSGRQFSQLA FAWQASEHEH       120
     LDVALSGRKV YYRGQHCWLL NIQLNPSNRS RHMDDLDAFL VAQSALDSLS ELICLKDNDG       180
     KILATNRAFE LFWEGRRDEA IMPESRLMKG RQSERRWTTD PQGRSCLLEV NQSLLMTKAG       240
     EPIGTLSISH DVTEWHAMQQ NLRDEMERRK DTEVALAQRD TILQNILEAS PDSIGIFNEN       300
     LVYQACNEPF VRALGIADVN DLIGKRLQDV VPGEMYQRLS VTDSQVLHEG KSLRYIDKVL       360
     DSNGEYAWYD VVKSPFRDPA SGTNGVLIMA RDISERYLAE QKLEAANLEL EKLSFMDSLT       420
     QVSNRRRFDE QLNTLWFHHA REKLPLTIML CDIDFFKEFN DRYGHQAGDE ALIQVATVFS       480
     QVVSRSSDCV ARYGGEEFAL LLPNTTAEGA LKVAEKIHAY IAESNIAHQG SKIAGRVTIS       540
     IGLVSYIPSP EDVPDMGVAL ADSALYQAKS DGRNRTCVHP ISLSSGESPS TLAQGNPPYA       600
     N                                                                       601
//

If you have problems or comments...

PBIL Back to PBIL home page