(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0647

BA000037.VV0647      Location/Qualifiers
FT   CDS             643224..643631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0647"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93411"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93411"
FT                   /db_xref="InterPro:IPR021710"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNR8"
FT                   /protein_id="BAC93411.1"
FT                   /translation="MINNGETTVDASLWHAYSASFFHFNDEWQSDRFAIITAWNPASIL
FT                   QSKKENCISNQKLKTKINTRRFCSVLVADKACCWSEESFAVEINLNYALNLAREFKQNA
FT                   IYFVEQGELFLVSCLSDERKESLGPFDQRIR"
     MINNGETTVD ASLWHAYSAS FFHFNDEWQS DRFAIITAWN PASILQSKKE NCISNQKLKT        60
     KINTRRFCSV LVADKACCWS EESFAVEINL NYALNLAREF KQNAIYFVEQ GELFLVSCLS       120
     DERKESLGPF DQRIR                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page