(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0666

BA000037.VV0666      Location/Qualifiers
FT   CDS             661927..662721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0666"
FT                   /product="protein-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93430"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93430"
FT                   /db_xref="GOA:Q7MNP9"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNP9"
FT                   /protein_id="BAC93430.1"
FT                   /translation="MILMSVLRRLTLLTLPLFVTACGAEESQAVETAQPAAQVAASTHF
FT                   DSEALKARFSKLGLNIMDIQPSDVAGLVEIQTSGGVLFASKDGSHFIAGTLYSIDENGQ
FT                   YKDVIAERQAPLNAKKIAEFADSAIEYKAKDEKYVVTVFTDITCGYCVRLHSQMQGYND
FT                   LGITVRYMAYPRQGGTGPVAEQMAGIWCAANPQEAMHDAKVNRKFAPAKNDLQQCKQTV
FT                   AQHYQLGQQLGITGTPAIFLPNGELVAGYLPPEKLLERLQQP"
     MILMSVLRRL TLLTLPLFVT ACGAEESQAV ETAQPAAQVA ASTHFDSEAL KARFSKLGLN        60
     IMDIQPSDVA GLVEIQTSGG VLFASKDGSH FIAGTLYSID ENGQYKDVIA ERQAPLNAKK       120
     IAEFADSAIE YKAKDEKYVV TVFTDITCGY CVRLHSQMQG YNDLGITVRY MAYPRQGGTG       180
     PVAEQMAGIW CAANPQEAMH DAKVNRKFAP AKNDLQQCKQ TVAQHYQLGQ QLGITGTPAI       240
     FLPNGELVAG YLPPEKLLER LQQP                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page