(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0668

BA000037.VV0668      Location/Qualifiers
FT   CDS             664885..665754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0668"
FT                   /product="protein chain release factor B"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93432"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93432"
FT                   /db_xref="GOA:Q7MNP7"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNP7"
FT                   /protein_id="BAC93432.1"
FT                   /translation="MDDVEGLLELAIEAEDQETFDEIGPELEALEEKLAGLEFRRMFSG
FT                   AHDSSDCYIDLQAGSGGTEAQDWTSMMLRMYLRWAEAKGFKTEVIEVSEGDVAGLKSVT
FT                   VRIIGDYAYGWLRTETGVHRLVRKSPFDSGGRRHTSFASAFVYPEIDENIDIDINPADL
FT                   RIDVYRASGAGGQHVNTTESAVRITHVPTNTVVQCQNDRSQHKNKDQAMKQLRAKLFEL
FT                   ELQKQNAEKQANEDAKSDIGWGSQIRSYVLDDSRIKDLRTGVENRNTQAVLDGDLDKFI
FT                   EASLKSGL"
     MDDVEGLLEL AIEAEDQETF DEIGPELEAL EEKLAGLEFR RMFSGAHDSS DCYIDLQAGS        60
     GGTEAQDWTS MMLRMYLRWA EAKGFKTEVI EVSEGDVAGL KSVTVRIIGD YAYGWLRTET       120
     GVHRLVRKSP FDSGGRRHTS FASAFVYPEI DENIDIDINP ADLRIDVYRA SGAGGQHVNT       180
     TESAVRITHV PTNTVVQCQN DRSQHKNKDQ AMKQLRAKLF ELELQKQNAE KQANEDAKSD       240
     IGWGSQIRSY VLDDSRIKDL RTGVENRNTQ AVLDGDLDKF IEASLKSGL                   289
//

If you have problems or comments...

PBIL Back to PBIL home page