(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0673

BA000037.VV0673      Location/Qualifiers
FT   CDS             670898..671209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0673"
FT                   /product="hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93437"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93437"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNP2"
FT                   /protein_id="BAC93437.1"
FT                   /translation="MQKHQLDLWLHSKHHDHYVPPKMFVIGCSDANEYLLAIEYKHHLE
FT                   PIKQGEELMHFSSLDLVKEELLRLGVEKAYLRLHNVYEEVGSDRLASYYDIELQLTPH"
     MQKHQLDLWL HSKHHDHYVP PKMFVIGCSD ANEYLLAIEY KHHLEPIKQG EELMHFSSLD        60
     LVKEELLRLG VEKAYLRLHN VYEEVGSDRL ASYYDIELQL TPH                         103
//

If you have problems or comments...

PBIL Back to PBIL home page