(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0680

BA000037.VV0680      Location/Qualifiers
FT   CDS             complement(677838..678995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0680"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by GeneMark and Glimmer2"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93444"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93444"
FT                   /db_xref="InterPro:IPR012548"
FT                   /db_xref="InterPro:IPR012656"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNN5"
FT                   /protein_id="BAC93444.1"
FT                   /translation="MYTMMEHKENQQRLEAARKIDDQLSLLVENIDILSSVTPQNYKEE
FT                   RQRFFDNRFSIEPSFTYKDQTFDVHQAKRNLYSLPIENIDSVKLRALYAEVIQSYADKL
FT                   DQLCSIGNAEFLYNSLRYYGEPSSKDIRNANFLLHLPIEEEASQRHDCHEIAAFMQQFC
FT                   QDHGYTGEIEINNSMIANALVSGTKVKINASASITTKEMHALAHHELGVHLLTTLNGRA
FT                   QPLKLLSLGCPVNTTTQEGLAILCEFLSGHFSLKRLRTLALRVIAVESMIKDRDFRNTF
FT                   LLLKEQYKTDDMTAFTITARVYRGGGYTKDYLYLRGFREILNAYDQLGDDFNLLLAGKT
FT                   EIRYFSTIKSLVADGLIQPPKFISPAIAKPAPADPIYKFVANALK"
     MYTMMEHKEN QQRLEAARKI DDQLSLLVEN IDILSSVTPQ NYKEERQRFF DNRFSIEPSF        60
     TYKDQTFDVH QAKRNLYSLP IENIDSVKLR ALYAEVIQSY ADKLDQLCSI GNAEFLYNSL       120
     RYYGEPSSKD IRNANFLLHL PIEEEASQRH DCHEIAAFMQ QFCQDHGYTG EIEINNSMIA       180
     NALVSGTKVK INASASITTK EMHALAHHEL GVHLLTTLNG RAQPLKLLSL GCPVNTTTQE       240
     GLAILCEFLS GHFSLKRLRT LALRVIAVES MIKDRDFRNT FLLLKEQYKT DDMTAFTITA       300
     RVYRGGGYTK DYLYLRGFRE ILNAYDQLGD DFNLLLAGKT EIRYFSTIKS LVADGLIQPP       360
     KFISPAIAKP APADPIYKFV ANALK                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page