(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0681

BA000037.VV0681      Location/Qualifiers
FT   CDS             complement(679106..680356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0681"
FT                   /product="NptA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93445"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93445"
FT                   /db_xref="GOA:Q7MNN4"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR030147"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNN4"
FT                   /protein_id="BAC93445.1"
FT                   /translation="MTPNCHITEIFHLYYRPQFQQQTKLRFRRSMEKIMMNQATTAATP
FT                   ISSTTRWLRWANLAFMLYLLLLAVSMVGSGFKLATGDQAKVLFEFASHPVAGLMIGLVA
FT                   TALIQSSSTVTSIIVGLVAGGLPVETAIPMVMGANIGTTVTNTLVSLGHVRCKEEFKRA
FT                   FASATIHDFFNLLAVAIFLPLEMMFGILEKVSHWLVSPLLNTGDMSMKGFDFIKPITKP
FT                   VVSAVKGPLSTFGDTFAGVALIVLGIATIFVAITVMGKLMKSLMVGRARDILKNAIGRG
FT                   PIHGIVSGSIVTVLVQSSSTTTSLMVPLVGTGVLKVRDVYPFTLGANIGTCITALLAAT
FT                   AVSGEFAVFALQIALVHLTFNVLATLFIFGIPFLREIPIKGAEFISEMAIKNKAVVAGY
FT                   LLAVFIFIPGSILALTA"
     MTPNCHITEI FHLYYRPQFQ QQTKLRFRRS MEKIMMNQAT TAATPISSTT RWLRWANLAF        60
     MLYLLLLAVS MVGSGFKLAT GDQAKVLFEF ASHPVAGLMI GLVATALIQS SSTVTSIIVG       120
     LVAGGLPVET AIPMVMGANI GTTVTNTLVS LGHVRCKEEF KRAFASATIH DFFNLLAVAI       180
     FLPLEMMFGI LEKVSHWLVS PLLNTGDMSM KGFDFIKPIT KPVVSAVKGP LSTFGDTFAG       240
     VALIVLGIAT IFVAITVMGK LMKSLMVGRA RDILKNAIGR GPIHGIVSGS IVTVLVQSSS       300
     TTTSLMVPLV GTGVLKVRDV YPFTLGANIG TCITALLAAT AVSGEFAVFA LQIALVHLTF       360
     NVLATLFIFG IPFLREIPIK GAEFISEMAI KNKAVVAGYL LAVFIFIPGS ILALTA           416
//

If you have problems or comments...

PBIL Back to PBIL home page