(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0684

BA000037.VV0684      Location/Qualifiers
FT   CDS             complement(682074..682349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0684"
FT                   /product="ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93448"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93448"
FT                   /db_xref="GOA:Q7MNN1"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7MNN1"
FT                   /protein_id="BAC93448.1"
FT                   /translation="MGVRPLANNKSAKKRAIQAEKRRQHNASRRSMMRTYMKKTVAAIA
FT                   AGDKEAATAAFAVVTPILDRMATKGLIHKNKAARHKSRFAAQIKAL"
     MGVRPLANNK SAKKRAIQAE KRRQHNASRR SMMRTYMKKT VAAIAAGDKE AATAAFAVVT        60
     PILDRMATKG LIHKNKAARH KSRFAAQIKA L                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page