(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0703

BA000037.VV0703      Location/Qualifiers
FT   CDS             complement(701583..702587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0703"
FT                   /product="membrane protein"
FT                   /note="related to metalloendopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93467"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93467"
FT                   /db_xref="GOA:Q7MNL2"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNL2"
FT                   /protein_id="BAC93467.1"
FT                   /translation="MSKKITMQIPTKNGDQLFYLGKGTVATLLLSITAFPLVLGGGWYW
FT                   YLQQSEQSQQLRAQLDVLASEKQQLMADYQEQLDTNHSLSQTLTEKSNQIQLLGKRVFD
FT                   VESVLGIADEEIIVDENSLEERIDTAAIDSAVRATMFRLIPNDSPMSYLRVSSSFGRRT
FT                   NPISGKRHTHTGIDLTCKRGEEIVAPADGVIETVRPSKKGFGNFITMRHSFGFMSSYAH
FT                   LQSFKVKSGQFVSKGDVIATCGNSGNSTGPHLHYEVRFLGRALNPQYTMDWNQENFNYL
FT                   FEKEKTVKWSPLVKMIDNVVRLQVNLTKSPYRDTSIDTVSSEENSLDPSLQTN"
     MSKKITMQIP TKNGDQLFYL GKGTVATLLL SITAFPLVLG GGWYWYLQQS EQSQQLRAQL        60
     DVLASEKQQL MADYQEQLDT NHSLSQTLTE KSNQIQLLGK RVFDVESVLG IADEEIIVDE       120
     NSLEERIDTA AIDSAVRATM FRLIPNDSPM SYLRVSSSFG RRTNPISGKR HTHTGIDLTC       180
     KRGEEIVAPA DGVIETVRPS KKGFGNFITM RHSFGFMSSY AHLQSFKVKS GQFVSKGDVI       240
     ATCGNSGNST GPHLHYEVRF LGRALNPQYT MDWNQENFNY LFEKEKTVKW SPLVKMIDNV       300
     VRLQVNLTKS PYRDTSIDTV SSEENSLDPS LQTN                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page