(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0710

BA000037.VV0710      Location/Qualifiers
FT   CDS             complement(709384..709707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0710"
FT                   /product="putative sigma-54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93474"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93474"
FT                   /db_xref="GOA:Q7MNK5"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNK5"
FT                   /protein_id="BAC93474.1"
FT                   /translation="MKLNITGKNIEITSAIRNHIESKFKKLEKWQTDIISCQTTFSEEP
FT                   GKQMKFEAVIKVPKGQLIASAIHEDLYAAINEVEQKLERQLNKLQHKPDARRAEKPEVV
FT                   EEE"
     MKLNITGKNI EITSAIRNHI ESKFKKLEKW QTDIISCQTT FSEEPGKQMK FEAVIKVPKG        60
     QLIASAIHED LYAAINEVEQ KLERQLNKLQ HKPDARRAEK PEVVEEE                     107
//

If you have problems or comments...

PBIL Back to PBIL home page