(data stored in SCRATCH3701 zone)

EMBL: BA000037.VV0724

BA000037.VV0724      Location/Qualifiers
FT   CDS             727533..728831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="VV0724"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BAC93488"
FT                   /db_xref="EnsemblGenomes-Tr:BAC93488"
FT                   /db_xref="GOA:Q7MNJ3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7MNJ3"
FT                   /protein_id="BAC93488.1"
FT                   /translation="MVERLTWKKLAWELAFFYTPWVIVGWIFGYMPWLLLVATALQLGW
FT                   HLHNQVRLSAWLWDEKRLTPPSGSGNWESLFNGLYRLQQRQRRKRKELTNLIRRFRNGA
FT                   ESLPDAVVVFRAEGNIVWCNKLAQHLLGFHWPEDSGQPISNLLRTPDFIKYLSGNDFSE
FT                   PLEMSSPLNVERTLELRIVPYTEGEHLMVVRDVTQLKQLEGMRRNFFANVSHELRTPMT
FT                   VLQGYLEMTEDPDMLVGPMWGKAHRVMTEQLNRMNSLVNQLLTLSKIEASPIHELDEVV
FT                   DVPAMLEVLEKEAVSLSGDNQHAISFQVDKALKVYADEDQLRSAISNLVYNAVKYTPAG
FT                   ANVQVRWYRNSKGACLEVEDSGDGIEPQHIHRLTERFYRVDKARSRDTGGSGLGLAIVK
FT                   HALTHHDTHLDIQSKVGSGSKFSFVLPAKLVAK"
     MVERLTWKKL AWELAFFYTP WVIVGWIFGY MPWLLLVATA LQLGWHLHNQ VRLSAWLWDE        60
     KRLTPPSGSG NWESLFNGLY RLQQRQRRKR KELTNLIRRF RNGAESLPDA VVVFRAEGNI       120
     VWCNKLAQHL LGFHWPEDSG QPISNLLRTP DFIKYLSGND FSEPLEMSSP LNVERTLELR       180
     IVPYTEGEHL MVVRDVTQLK QLEGMRRNFF ANVSHELRTP MTVLQGYLEM TEDPDMLVGP       240
     MWGKAHRVMT EQLNRMNSLV NQLLTLSKIE ASPIHELDEV VDVPAMLEVL EKEAVSLSGD       300
     NQHAISFQVD KALKVYADED QLRSAISNLV YNAVKYTPAG ANVQVRWYRN SKGACLEVED       360
     SGDGIEPQHI HRLTERFYRV DKARSRDTGG SGLGLAIVKH ALTHHDTHLD IQSKVGSGSK       420
     FSFVLPAKLV AK                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page