(data stored in ACNUC1829 zone)

EMBL: BC003482.TSPAN4

BC003482.TSPAN4      Location/Qualifiers
FT   CDS             60..776
FT                   /codon_start=1
FT                   /gene="Tspan4"
FT                   /product="Tspan4 protein"
FT                   /db_xref="GOA:Q9DCK3"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="MGI:MGI:1928097"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DCK3"
FT                   /protein_id="AAH03482.1"
FT                   /translation="MARGCLQGVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGNFATLS
FT                   SSFPSLSAANLLIVTGTFVMAIGFVGCIGALKENKCLLLTFFVLLLLVFLLEATIAVLF
FT                   FAYSDKIDSYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNAT
FT                   RVPDSCCLEFSDSCGLHEPGTWWKSPCYETVKAWLQENLLAVGIFGLCTALVQILGLTF
FT                   AMTMYCQVVKADTYCA"
     MARGCLQGVK YLMFAFNLLF WLGGCGVLGV GIWLAATQGN FATLSSSFPS LSAANLLIVT        60
     GTFVMAIGFV GCIGALKENK CLLLTFFVLL LLVFLLEATI AVLFFAYSDK IDSYAQQDLK       120
     KGLHLYGTQG NVGLTNAWSI IQTDFRCCGV SNYTDWFEVY NATRVPDSCC LEFSDSCGLH       180
     EPGTWWKSPC YETVKAWLQE NLLAVGIFGL CTALVQILGL TFAMTMYCQV VKADTYCA         238
//

If you have problems or comments...

PBIL Back to PBIL home page