(data stored in ACNUC15465 zone)

EMBL: BC024914.GAGE5

BC024914.GAGE5       Location/Qualifiers
FT   CDS             88..441
FT                   /codon_start=1
FT                   /gene="GAGE5"
FT                   /product="G antigen 5"
FT                   /db_xref="GOA:Q13069"
FT                   /db_xref="H-InvDB:HIT000039843_06.4"
FT                   /db_xref="HGNC:HGNC:4102"
FT                   /db_xref="InterPro:IPR008625"
FT                   /db_xref="InterPro:IPR031320"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13069"
FT                   /protein_id="AAH24914.1"
FT                   /translation="MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGE
FT                   PATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEE
FT                   VKTPEEGEKQSQC"
     MSWRGRSTYY WPRPRRYVQP PEVIGPMRPE QFSDEVEPAT PEEGEPATQR QDPAAAQEGE        60
     DEGASAGQGP KPEADSQEQG HPQTGCECED GPDGQEMDPP NPEEVKTPEE GEKQSQC          117
//

If you have problems or comments...

PBIL Back to PBIL home page