(data stored in ACNUC22857 zone)

EMBL: BC063350.AP2B1

BC063350.AP2B1       Location/Qualifiers
FT   CDS             218..3073
FT                   /codon_start=1
FT                   /gene="ap2b1"
FT                   /product="adaptor-related protein complex 2, beta 1
FT                   subunit"
FT                   /db_xref="GOA:Q6P4L7"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013037"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015151"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:Q6P4L7"
FT                   /protein_id="AAH63350.1"
FT                   /translation="MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGK
FT                   DVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRA
FT                   LAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLD
FT                   SLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFI
FT                   LDCLSNYNPKDEREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYTMLL
FT                   KKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLD
FT                   IMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLI
FT                   QTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARGAMIWIVGEYAER
FT                   IDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNP
FT                   DLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHK
FT                   PPNAFVEGSHGVHRKHLPIQHGSIDIGDSPVGPTPSAGLEQPQVIPSQGDLLGDLLNLD
FT                   LGPPGNVPQVSTMQMGAVDLLGGGLDSLLGSDLGGGIGGSPAVGQTFIPSSVPATFAPS
FT                   PTPAVVSSGLNDLFELSSGIGMAPGGYVSQKAVWLPAVKAKGLEISGTFSHRQAHIYMD
FT                   MSFTNKALQHMTDFAIQFNKNSFGVIPSAPLAIHTPLMPNQSIDISLPLNTLGPVMKME
FT                   PLNNLQVAVKNNIDVFYFSCLIPLHVLFVEDGKMERQVFLATWKDIPNENELQFQIKDC
FT                   HLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSL
FT                   KCRAPEVCNYVYQVYDSILKN"
     MTDSKYFTTN KKGEIFELKA ELNNEKKEKR KEAVKKVIAA MTVGKDVSSL FPDVVNCMQT        60
     DNLELKKLVY LYLMNYAKSQ PDMAIMAVNS FVKDCEDPNP LIRALAVRTM GCIRVDKITE       120
     YLCEPLRKCL KDEDPYVRKT AAVCVAKLHD INAQMVEDQG FLDSLRDLIA DSNPMVVANA       180
     VAALSEISES HPNSNLLDLN PQNINKLLTA LNECTEWGQI FILDCLSNYN PKDEREAQSI       240
     CERVTPRLSH ANSAVVLSAV KVLMKFLELL PKDSDYYTML LKKLAPPLVT LLSGEPEVQY       300
     VALRNINLIV QKRPEILKQE IKVFFVKYND PIYVKLEKLD IMIRLASQAN IAQVLAELKE       360
     YATEVDVDFV RKAVRAIGRC AIKVEQSAER CVSTLLDLIQ TKVNYVVQEA IVVIRDIFRK       420
     YPNKYESIIA TLCENLDSLD EPDARGAMIW IVGEYAERID NADELLESFL EGFHDESTQV       480
     QLTLLTAIVK LFLKKPSETQ ELVQQVLSLA TQDSDNPDLR DRGYIYWRLL STDPVTAKEV       540
     VLSEKPLISE ETDLIEPTLL DELICHIGSL ASVYHKPPNA FVEGSHGVHR KHLPIQHGSI       600
     DIGDSPVGPT PSAGLEQPQV IPSQGDLLGD LLNLDLGPPG NVPQVSTMQM GAVDLLGGGL       660
     DSLLGSDLGG GIGGSPAVGQ TFIPSSVPAT FAPSPTPAVV SSGLNDLFEL SSGIGMAPGG       720
     YVSQKAVWLP AVKAKGLEIS GTFSHRQAHI YMDMSFTNKA LQHMTDFAIQ FNKNSFGVIP       780
     SAPLAIHTPL MPNQSIDISL PLNTLGPVMK MEPLNNLQVA VKNNIDVFYF SCLIPLHVLF       840
     VEDGKMERQV FLATWKDIPN ENELQFQIKD CHLNADTVSS KLQNNNVYTI AKRNVEGQDM       900
     LYQSLKLTNG IWILAELRIQ PGNPNYTLSL KCRAPEVCNY VYQVYDSILK N                951
//

If you have problems or comments...

PBIL Back to PBIL home page