(data stored in ACNUC27125 zone)

EMBL: BC065500.FAM21A

BC065500.FAM21A      Location/Qualifiers
FT   CDS             <1..382
FT                   /codon_start=2
FT                   /gene="FAM21A"
FT                   /product="FAM21A protein"
FT                   /db_xref="H-InvDB:HIT000261908.13"
FT                   /db_xref="UniProtKB/TrEMBL:Q6P0Q7"
FT                   /protein_id="AAH65500.1"
FT                   /translation="KNETKSNSQQDVILTTQDIFEDDIFATEAIKPSQKTREKEKTLES
FT                   NLFDDNIDIFADLTVKPKEKSKKKVEAKSIFDDDMDDIFSSGIQAKTTKPKSRSAQAAP
FT                   EPRFEHKVSNIFDDPLNAFGGQ"
     KNETKSNSQQ DVILTTQDIF EDDIFATEAI KPSQKTREKE KTLESNLFDD NIDIFADLTV        60
     KPKEKSKKKV EAKSIFDDDM DDIFSSGIQA KTTKPKSRSA QAAPEPRFEH KVSNIFDDPL       120
     NAFGGQ                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page