(data stored in ACNUC22857 zone)

EMBL: BC066566.AP2B1

BC066566.AP2B1       Location/Qualifiers
FT   CDS             119..2974
FT                   /codon_start=1
FT                   /gene="ap2b1"
FT                   /product="adaptor-related protein complex 2, beta 1
FT                   subunit"
FT                   /db_xref="GOA:Q6NYJ9"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR013037"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR015151"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="InterPro:IPR026739"
FT                   /db_xref="UniProtKB/TrEMBL:Q6NYJ9"
FT                   /db_xref="ZFIN:ZDB-GENE-030131-6564"
FT                   /protein_id="AAH66566.1"
FT                   /translation="MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGK
FT                   DVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRA
FT                   LAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLD
FT                   SLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFI
FT                   LDCLSNYNPKDEREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNTLL
FT                   KKLSPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLD
FT                   IMIRLASHANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLI
FT                   QTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARGAMIWIVGEYAER
FT                   IDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNP
FT                   DLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHK
FT                   PPNAFVEGSHGIHRKHLPIQHGSIDTGESPVSTGPAASIDQPQVIPSQGDLLGDLLNLD
FT                   LGPPVNVPQVSSMQIAAVDLLGGGLDSLLGGDLGGGVGGSPAVGQNFIPSSVPNTFAPS
FT                   PTPAALSSGLNDLFELSTGMATATGGYVAAKTVWLPAVKAKGLEISGTFSRRQGHMYMD
FT                   MTFTNKALQHMTDFAIQFNKNSFGVIPTTPLPVHTPLMPSQSIDISLPLNTIGPVMKMD
FT                   PLNNLQVAVKNNIDVFYFSTLIPLNVFFVEDGKMERQVFLATWKDIPNENELQYQIKDC
FT                   HLNADTVSGKLQSNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSL
FT                   KCRAPEVSQYVYQMYDATLKN"
     MTDSKYFTTN KKGEIFELKA ELNNEKKEKR KEAVKKVIAA MTVGKDVSSL FPDVVNCMQT        60
     DNLELKKLVY LYLMNYAKSQ PDMAIMAVNS FVKDCEDPNP LIRALAVRTM GCIRVDKITE       120
     YLCEPLRKCL KDEDPYVRKT AAVCVAKLHD INAQMVEDQG FLDSLRDLIA DSNPMVVANA       180
     VAALSEISES HPNSNLLDLN PQNINKLLTA LNECTEWGQI FILDCLSNYN PKDEREAQSI       240
     CERVTPRLSH ANSAVVLSAV KVLMKFLELL PKDSDYYNTL LKKLSPPLVT LLSGEPEVQY       300
     VALRNINLIV QKRPEILKQE IKVFFVKYND PIYVKLEKLD IMIRLASHAN IAQVLAELKE       360
     YATEVDVDFV RKAVRAIGRC AIKVEQSAER CVSTLLDLIQ TKVNYVVQEA IVVIRDIFRK       420
     YPNKYESIIA TLCENLDSLD EPDARGAMIW IVGEYAERID NADELLESFL EGFHDESTQV       480
     QLTLLTAIVK LFLKKPSETQ ELVQQVLSLA TQDSDNPDLR DRGYIYWRLL STDPVTAKEV       540
     VLSEKPLISE ETDLIEPTLL DELICHIGSL ASVYHKPPNA FVEGSHGIHR KHLPIQHGSI       600
     DTGESPVSTG PAASIDQPQV IPSQGDLLGD LLNLDLGPPV NVPQVSSMQI AAVDLLGGGL       660
     DSLLGGDLGG GVGGSPAVGQ NFIPSSVPNT FAPSPTPAAL SSGLNDLFEL STGMATATGG       720
     YVAAKTVWLP AVKAKGLEIS GTFSRRQGHM YMDMTFTNKA LQHMTDFAIQ FNKNSFGVIP       780
     TTPLPVHTPL MPSQSIDISL PLNTIGPVMK MDPLNNLQVA VKNNIDVFYF STLIPLNVFF       840
     VEDGKMERQV FLATWKDIPN ENELQYQIKD CHLNADTVSG KLQSNNVYTI AKRNVEGQDM       900
     LYQSLKLTNG IWILAELRIQ PGNPNYTLSL KCRAPEVSQY VYQMYDATLK N                951
//

If you have problems or comments...

PBIL Back to PBIL home page