(data stored in ACNUC17492 zone)

EMBL: BC098681.RGS1

BC098681.RGS1        Location/Qualifiers
FT   CDS             197..685
FT                   /codon_start=1
FT                   /gene="Rgs1"
FT                   /product="regulator of G-protein signaling 1"
FT                   /db_xref="GOA:P97844"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="InterPro:IPR030409"
FT                   /db_xref="InterPro:IPR036305"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97844"
FT                   /protein_id="AAH98681.1"
FT                   /translation="MDMKAYLRSMIPHLESGMKSSKSKDILSAEEVMQWSQSLEKLLAN
FT                   QMGQNVFGKFLKSEFSEENIEFWLACEDYKKTETDLLHNKAEHIYKAFVHSDAVKQINI
FT                   DFHTRESTAKKIKTPTPTCFDEAQKVIYALMEKDSYPRFLKSNIYLNLLNDLQANTLK"
     MDMKAYLRSM IPHLESGMKS SKSKDILSAE EVMQWSQSLE KLLANQMGQN VFGKFLKSEF        60
     SEENIEFWLA CEDYKKTETD LLHNKAEHIY KAFVHSDAVK QINIDFHTRE STAKKIKTPT       120
     PTCFDEAQKV IYALMEKDSY PRFLKSNIYL NLLNDLQANT LK                          162
//

If you have problems or comments...

PBIL Back to PBIL home page