(data stored in ACNUC26462 zone)

EMBL: BC106755.CAMK1

BC106755.CAMK1       Location/Qualifiers
FT   CDS             147..1259
FT                   /codon_start=1
FT                   /gene="CAMK1"
FT                   /product="calcium/calmodulin-dependent protein kinase I"
FT                   /db_xref="GOA:Q14012"
FT                   /db_xref="H-InvDB:HIT000338498.9"
FT                   /db_xref="HGNC:HGNC:1459"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:4FG7"
FT                   /db_xref="PDB:4FG8"
FT                   /db_xref="PDB:4FG9"
FT                   /db_xref="PDB:4FGB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q14012"
FT                   /protein_id="AAI06756.1"
FT                   /translation="MLGAVEGPRWKQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKL
FT                   VAIKCIAKEALEGKEGSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGGELF
FT                   DRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDF
FT                   GLSKMEDPGSVLSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDEN
FT                   DAKLFEQILKAEYEFDSPYWDDISDSAKDFIRHLMEKDPEKRFTCEQALQHPWIAGDTA
FT                   LDKNIHQSVSEQIKKNFAKSKWKQAFNATAVVRHMRKLQLGTSQEGQGQTASHGELLTP
FT                   VAGGPAAGCCCRDCCVEPGTELSPTLPHQL"
     MLGAVEGPRW KQAEDIRDIY DFRDVLGTGA FSEVILAEDK RTQKLVAIKC IAKEALEGKE        60
     GSMENEIAVL HKIKHPNIVA LDDIYESGGH LYLIMQLVSG GELFDRIVEK GFYTERDASR       120
     LIFQVLDAVK YLHDLGIVHR DLKPENLLYY SLDEDSKIMI SDFGLSKMED PGSVLSTACG       180
     TPGYVAPEVL AQKPYSKAVD CWSIGVIAYI LLCGYPPFYD ENDAKLFEQI LKAEYEFDSP       240
     YWDDISDSAK DFIRHLMEKD PEKRFTCEQA LQHPWIAGDT ALDKNIHQSV SEQIKKNFAK       300
     SKWKQAFNAT AVVRHMRKLQ LGTSQEGQGQ TASHGELLTP VAGGPAAGCC CRDCCVEPGT       360
     ELSPTLPHQL                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page