(data stored in ACNUC15260 zone)

EMBL: BC106778

BC106778             Location/Qualifiers
FT   CDS             1..918
FT                   /codon_start=1
FT                   /gene="Olfr99"
FT                   /product="olfactory receptor 99"
FT                   /db_xref="GOA:Q8VFE4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2177482"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFE4"
FT                   /protein_id="AAI06779.1"
FT                   /translation="MNCSQAPTLILLGLSSDAEKWQPLFSIFLVIYLLGLLGNLLLLLA
FT                   IGTDVHLHTPMYFFLSQLSFVDLCFITTTAPKMLEALWTGDGSISFSGCLTQLYFFAVF
FT                   ADMDNLLLAVMAIDRYAAICHPLRYSALMTPFRCGVLVSGSWGVTNCVSLTHTLLLSKL
FT                   YFHTNQEIPHFFCEFGPLLLLSCSDTHLNKILVIILVGILGISAVLCIVSSYGCIFYAV
FT                   AKVPSAQGKRKALSTCSSHLSVVLLFYSTVFATYLKPPSSSRSSEEVVAAVMYSLVTPT
FT                   LNPFIYSLRNKDVKSSLRRILNME"
     MNCSQAPTLI LLGLSSDAEK WQPLFSIFLV IYLLGLLGNL LLLLAIGTDV HLHTPMYFFL        60
     SQLSFVDLCF ITTTAPKMLE ALWTGDGSIS FSGCLTQLYF FAVFADMDNL LLAVMAIDRY       120
     AAICHPLRYS ALMTPFRCGV LVSGSWGVTN CVSLTHTLLL SKLYFHTNQE IPHFFCEFGP       180
     LLLLSCSDTH LNKILVIILV GILGISAVLC IVSSYGCIFY AVAKVPSAQG KRKALSTCSS       240
     HLSVVLLFYS TVFATYLKPP SSSRSSEEVV AAVMYSLVTP TLNPFIYSLR NKDVKSSLRR       300
     ILNME                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page