(data stored in ACNUC10409 zone)

EMBL: BC120986.TM6SF2

BC120986.TM6SF2      Location/Qualifiers
FT   CDS             25..>1010
FT                   /codon_start=1
FT                   /gene="TM6SF2"
FT                   /product="TM6SF2 protein"
FT                   /db_xref="GOA:Q9BZW4"
FT                   /db_xref="H-InvDB:HIT000388183.7"
FT                   /db_xref="HGNC:HGNC:11861"
FT                   /db_xref="InterPro:IPR033118"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9BZW4"
FT                   /protein_id="AAI20987.1"
FT                   /translation="MDIPPLAGKIAALSLSALPVSYALNHVSALSHPLWVALMSALILG
FT                   LLFVAVYSLSHGEVSYDPLYAVFAVFAFTSVVDLIIALQEDSYVVGFMEFYTKEGEPYL
FT                   RTAHGVFICYWDGTVHYLLYLAMAGAICRRKRYRNFGLYWLGSFAMSILVFLTGNILGK
FT                   YSSEIRPAFFLTIPYLLVPCWAGMKVFSQPRALTRCTANMVQEEQRKGLLQRPADLALV
FT                   IYLILAGFFTLFRGLVVLDCPTDACFVYIYQYEPYLRDPVAYPKVQMLMYMFYVLPFCG
FT                   LAAYALTFPGCSWLPDWALVFAGGIGQAQFSHMGASMHLRTPFTYRVP"
     MDIPPLAGKI AALSLSALPV SYALNHVSAL SHPLWVALMS ALILGLLFVA VYSLSHGEVS        60
     YDPLYAVFAV FAFTSVVDLI IALQEDSYVV GFMEFYTKEG EPYLRTAHGV FICYWDGTVH       120
     YLLYLAMAGA ICRRKRYRNF GLYWLGSFAM SILVFLTGNI LGKYSSEIRP AFFLTIPYLL       180
     VPCWAGMKVF SQPRALTRCT ANMVQEEQRK GLLQRPADLA LVIYLILAGF FTLFRGLVVL       240
     DCPTDACFVY IYQYEPYLRD PVAYPKVQML MYMFYVLPFC GLAAYALTFP GCSWLPDWAL       300
     VFAGGIGQAQ FSHMGASMHL RTPFTYRV                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page