(data stored in ACNUC12215 zone)

EMBL: BC137522.XKR3

BC137522.XKR3        Location/Qualifiers
FT   CDS             71..1450
FT                   /codon_start=1
FT                   /gene="XKR3"
FT                   /product="XK, Kell blood group complex subunit-related
FT                   family, member 3"
FT                   /db_xref="GOA:Q5GH77"
FT                   /db_xref="H-InvDB:HIT000501412.4"
FT                   /db_xref="HGNC:HGNC:28778"
FT                   /db_xref="InterPro:IPR018629"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5GH77"
FT                   /protein_id="AAI37523.1"
FT                   /translation="METVFEEMDEESTGGVSSSKEEIVLGQRLHLSFPFSIIFSTVLYC
FT                   GEVAFGLYMFEIYRKANDTFWMSFTISFIIVGAILDQIILMFFNKDLRRNKAALLFWHI
FT                   LLLGPIVRCLHTIRNYHKWLKNLKQEKEETQVSITKRNTMLEREIAFSIRDNFMQQKAF
FT                   KYMSVIQAFLGSVPQLILQMYISLTIREWPLNRALLMTFSLLSVTYGAIRCNILAIQIS
FT                   NDDTTIKLPPIEFFCVVMWRFLEVISRVVTLAFFIASLKLKSLPVLLIIYFVSLLAPWL
FT                   EFWKSGAHLPGNKENNSNMVGTVLMLFLITLLYAAINFSCWSAVKLQLSDDKIIDGRQR
FT                   WGHRILHYSFQFLENVIMILVFRFFGGKTLLNCCDSLIAVQLIISYLLATGFMLLFYQY
FT                   LYPWQSGKVLPGRTENQPEAPYYYVNIEKTEKNKNKQLRNYCHSCNRVGYFSIRKSMTC
FT                   S"
     METVFEEMDE ESTGGVSSSK EEIVLGQRLH LSFPFSIIFS TVLYCGEVAF GLYMFEIYRK        60
     ANDTFWMSFT ISFIIVGAIL DQIILMFFNK DLRRNKAALL FWHILLLGPI VRCLHTIRNY       120
     HKWLKNLKQE KEETQVSITK RNTMLEREIA FSIRDNFMQQ KAFKYMSVIQ AFLGSVPQLI       180
     LQMYISLTIR EWPLNRALLM TFSLLSVTYG AIRCNILAIQ ISNDDTTIKL PPIEFFCVVM       240
     WRFLEVISRV VTLAFFIASL KLKSLPVLLI IYFVSLLAPW LEFWKSGAHL PGNKENNSNM       300
     VGTVLMLFLI TLLYAAINFS CWSAVKLQLS DDKIIDGRQR WGHRILHYSF QFLENVIMIL       360
     VFRFFGGKTL LNCCDSLIAV QLIISYLLAT GFMLLFYQYL YPWQSGKVLP GRTENQPEAP       420
     YYYVNIEKTE KNKNKQLRNY CHSCNRVGYF SIRKSMTCS                              459
//

If you have problems or comments...

PBIL Back to PBIL home page