(data stored in ACNUC30567 zone)

EMBL: BC140615.ADAM3A

BC140615.ADAM3A      Location/Qualifiers
FT   CDS             38..2251
FT                   /codon_start=1
FT                   /gene="ADAM3A"
FT                   /product="ADAM3A protein"
FT                   /db_xref="GOA:A5D7M5"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR006586"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR034027"
FT                   /db_xref="InterPro:IPR036436"
FT                   /db_xref="UniProtKB/TrEMBL:A5D7M5"
FT                   /protein_id="AAI40616.1"
FT                   /translation="MLSLLLLLTGLGQLASAGHHSETARLQITVPRKIETNTKDGSISE
FT                   THVAYSIQIDKKTYTLPLEKQSFLDSNLLVYSYNKSRVLYPDSSFIKGHCFYQGYATEI
FT                   PNSVVTLSTCSGLRGLLQFENVSYGIEPLESSTTYEHVIYPFRDKKSDFSPISADQSYK
FT                   ILVKSNKDSGVLLKRVLKIHVIIDKALYHYMGSEVALASEKIIYVFSLINTMYSQLQVS
FT                   VILTSLEIWSDLNKISTDGDAHDVLQRFVSWREKSLLQSSHDLAYLLIYRDHPNYVGAT
FT                   YHGMACDPKFAAGLALYSKMITLEAFSVIFTQLLGIMLGLKYNNNIYECSCPGIACIMN
FT                   PEAIRSHGIKFFSSCSIDEFKHTTSQPKFECLQNRTVPKVVPQGRQSICGNGVLEPPEQ
FT                   CDCGSIENCEHTKCCNPLNCVLIGNADCGSGPCCGKKTCMILDRGTECRRSTDPCDFPE
FT                   ICNGISEFCVPDMRAADLQTCNNKSSYCFRGICQDRTKQCVTLFGKYAKESSYQCTEEV
FT                   NYQDDDFGNCLGRTCFFHQHLCGKLVCHWTHSAIVSRNDIDVQYTYLGGHICMSANLRT
FT                   RRYPDPTVAANGSMCDENKFCDNGACRAIHQYTQYQDCDPLTKCKGHGICNTRLHCHCD
FT                   VGYVPPDCEEIALSPGGSIDDGFWNLEIDESKTAYLIKRRRASQKNNLMISFYVLLPFF
FT                   ILTAIIALKWNKMKIFWNKEGTISGGSPSEISNSNSSQSNSND"
     MLSLLLLLTG LGQLASAGHH SETARLQITV PRKIETNTKD GSISETHVAY SIQIDKKTYT        60
     LPLEKQSFLD SNLLVYSYNK SRVLYPDSSF IKGHCFYQGY ATEIPNSVVT LSTCSGLRGL       120
     LQFENVSYGI EPLESSTTYE HVIYPFRDKK SDFSPISADQ SYKILVKSNK DSGVLLKRVL       180
     KIHVIIDKAL YHYMGSEVAL ASEKIIYVFS LINTMYSQLQ VSVILTSLEI WSDLNKISTD       240
     GDAHDVLQRF VSWREKSLLQ SSHDLAYLLI YRDHPNYVGA TYHGMACDPK FAAGLALYSK       300
     MITLEAFSVI FTQLLGIMLG LKYNNNIYEC SCPGIACIMN PEAIRSHGIK FFSSCSIDEF       360
     KHTTSQPKFE CLQNRTVPKV VPQGRQSICG NGVLEPPEQC DCGSIENCEH TKCCNPLNCV       420
     LIGNADCGSG PCCGKKTCMI LDRGTECRRS TDPCDFPEIC NGISEFCVPD MRAADLQTCN       480
     NKSSYCFRGI CQDRTKQCVT LFGKYAKESS YQCTEEVNYQ DDDFGNCLGR TCFFHQHLCG       540
     KLVCHWTHSA IVSRNDIDVQ YTYLGGHICM SANLRTRRYP DPTVAANGSM CDENKFCDNG       600
     ACRAIHQYTQ YQDCDPLTKC KGHGICNTRL HCHCDVGYVP PDCEEIALSP GGSIDDGFWN       660
     LEIDESKTAY LIKRRRASQK NNLMISFYVL LPFFILTAII ALKWNKMKIF WNKEGTISGG       720
     SPSEISNSNS SQSNSND                                                      737
//

If you have problems or comments...

PBIL Back to PBIL home page