(data stored in ACNUC4305 zone)

EMBL: BC146052.MGC152639

BC146052.MGC152639   Location/Qualifiers
FT   CDS             111..1661
FT                   /codon_start=1
FT                   /gene="MGC152639"
FT                   /product="MGC152639 protein"
FT                   /db_xref="InterPro:IPR029357"
FT                   /db_xref="UniProtKB/TrEMBL:A6H6Z2"
FT                   /protein_id="AAI46053.1"
FT                   /translation="MDASRRVTATSVLPTFDASCLFKGHLSTKSNALCTDSSSLRLSTL
FT                   QLVKNHMAVHYNKILSAKAAVDCSVPLSMSASIKYADQQRREKLKKELARCGRGLKFTK
FT                   TTVHPKSHSRSLLNALQKPSGEPQDENSLLIEEVNEFPSFTQSPVISSERLSLPKSQNV
FT                   LTNCTEKNSSCSMSSMDYTASGSKKPSSGTSYGRGPRGTFPGSQKFQLVISKAPSGDLL
FT                   DKHSEHFSNRHLPFTPRTLKTEAKSFLSQYRYYTPAKRKKNFTNRRIEAETQTELSSFK
FT                   SDFETVEIKNATDSEMNVTQASGCVSYGTKGRTTPSASPGRELPWGKVRDSALQCSSPR
FT                   AVCQYSLQPPSGRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKH
FT                   HLEEEKMRQLLHVLKVDLGCMSKENSGKLDSVDTLHLCDVEKAENLEQNENKSEQDLII
FT                   QQERQEYQKALNMLLTIPKEENEIVSSNEFFLPIHKSKYSEEVIIQQYLKRQGLSSNQ"
     MDASRRVTAT SVLPTFDASC LFKGHLSTKS NALCTDSSSL RLSTLQLVKN HMAVHYNKIL        60
     SAKAAVDCSV PLSMSASIKY ADQQRREKLK KELARCGRGL KFTKTTVHPK SHSRSLLNAL       120
     QKPSGEPQDE NSLLIEEVNE FPSFTQSPVI SSERLSLPKS QNVLTNCTEK NSSCSMSSMD       180
     YTASGSKKPS SGTSYGRGPR GTFPGSQKFQ LVISKAPSGD LLDKHSEHFS NRHLPFTPRT       240
     LKTEAKSFLS QYRYYTPAKR KKNFTNRRIE AETQTELSSF KSDFETVEIK NATDSEMNVT       300
     QASGCVSYGT KGRTTPSASP GRELPWGKVR DSALQCSSPR AVCQYSLQPP SGRKIYSDEE       360
     ELLYLSFIED VTDEILKLGL FSNRFLERLF ERHIKQNKHH LEEEKMRQLL HVLKVDLGCM       420
     SKENSGKLDS VDTLHLCDVE KAENLEQNEN KSEQDLIIQQ ERQEYQKALN MLLTIPKEEN       480
     EIVSSNEFFL PIHKSKYSEE VIIQQYLKRQ GLSSNQ                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page