(data stored in ACNUC15260 zone)

EMBL: BC147455.OLFR310

BC147455.OLFR310     Location/Qualifiers
FT   CDS             25..1023
FT                   /codon_start=1
FT                   /gene="Olfr310"
FT                   /product="olfactory receptor 310"
FT                   /db_xref="GOA:B2RVZ1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030144"
FT                   /db_xref="UniProtKB/TrEMBL:B2RVZ1"
FT                   /protein_id="AAI47456.1"
FT                   /translation="MANSTLVTEFFLEVFAEIWELRILITVLFLLVYLCSLLGNLTIII
FT                   VTTVDQTLNTPMYFFLRNLSILDMGYISITVPSTCINSLTNHRNMSVAGCAAQIFSFLF
FT                   CACVEILVFSIMAQDRYVAICKPLLYPVIMNHQFCVQMTLASLLSSLVIASVHTFKTFQ
FT                   LSFCHSNVVPQFFCDLPALLRLSCSDTFSNKLLILLTVIGVSGSCFVFIAISYIHILST
FT                   VLKIPVKGERGKAFSTCVPHIIVVSVFVSSAAFVYLRPPVITFEVVQEMVISVFYTMVP
FT                   PFLNPIVYSLRNKQIKEAVRKVILRVFPIFEYKRNIYFSWYFRGKKTDKVR"
     MANSTLVTEF FLEVFAEIWE LRILITVLFL LVYLCSLLGN LTIIIVTTVD QTLNTPMYFF        60
     LRNLSILDMG YISITVPSTC INSLTNHRNM SVAGCAAQIF SFLFCACVEI LVFSIMAQDR       120
     YVAICKPLLY PVIMNHQFCV QMTLASLLSS LVIASVHTFK TFQLSFCHSN VVPQFFCDLP       180
     ALLRLSCSDT FSNKLLILLT VIGVSGSCFV FIAISYIHIL STVLKIPVKG ERGKAFSTCV       240
     PHIIVVSVFV SSAAFVYLRP PVITFEVVQE MVISVFYTMV PPFLNPIVYS LRNKQIKEAV       300
     RKVILRVFPI FEYKRNIYFS WYFRGKKTDK VR                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page