(data stored in ACNUC10243 zone)

EMBL: BC158074.EG627828

BC158074.EG627828    Location/Qualifiers
FT   CDS             29..1084
FT                   /codon_start=1
FT                   /gene="EG627828"
FT                   /product="EG627828 protein"
FT                   /db_xref="GOA:B2RXM2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034513"
FT                   /db_xref="InterPro:IPR034516"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="MGI:MGI:3643578"
FT                   /db_xref="UniProtKB/TrEMBL:B2RXM2"
FT                   /protein_id="AAI58075.1"
FT                   /translation="MEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVM
FT                   RDPQTKRSRGFGFVTYSCVEEVDAAMCARPYKVDGRVVEPKRAVSREDSVKPGAHLTVK
FT                   KIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVV
FT                   QKYHTINGHNCEVKKALSKQEMRSAGSQRDRGGGSGNFMGRGGNFGGGGGNFGGRGGYG
FT                   GGGGGSRGSYGGGDGGYNGFGGDGGNYGGGPGYSSRGGYGGGGPGYGNQGGGYGGGGGG
FT                   YDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKGGSFGGRSSGSPYGGGYGSG
FT                   GGSGGYGSRRF"
     MEGHDPKEPE QLRKLFIGGL SFETTDDSLR EHFEKWGTLT DCVVMRDPQT KRSRGFGFVT        60
     YSCVEEVDAA MCARPYKVDG RVVEPKRAVS REDSVKPGAH LTVKKIFVGG IKEDTEEYNL       120
     RDYFEKYGKI ETIEVMEDRQ SGKKRGFAFV TFDDHDTVDK IVVQKYHTIN GHNCEVKKAL       180
     SKQEMRSAGS QRDRGGGSGN FMGRGGNFGG GGGNFGGRGG YGGGGGGSRG SYGGGDGGYN       240
     GFGGDGGNYG GGPGYSSRGG YGGGGPGYGN QGGGYGGGGG GYDGYNEGGN FGGGNYGGGG       300
     NYNDFGNYSG QQQSNYGPMK GGSFGGRSSG SPYGGGYGSG GGSGGYGSRR F                351
//

If you have problems or comments...

PBIL Back to PBIL home page