(data stored in ACNUC4305 zone)

EMBL: BC167139.TM4SF1

BC167139.TM4SF1      Location/Qualifiers
FT   CDS             <1..572
FT                   /codon_start=3
FT                   /gene="tm4sf1"
FT                   /product="tm4sf1 protein"
FT                   /db_xref="GOA:B2RZF7"
FT                   /db_xref="InterPro:IPR008661"
FT                   /db_xref="UniProtKB/TrEMBL:B2RZF7"
FT                   /protein_id="AAI67139.1"
FT                   /translation="LILAIFCIAANILLFFPNGETQYASQNHLSRFVWFFHGIGGAGLL
FT                   MLLPAGVFIGLENEDCCGCCGNERCGKSCAMLSSILAALIGVAGAGYCVVISALGLAEG
FT                   PLCLNNNQWSYAFESTNGKYLTDYQSWSTCTEPRNVVVWNVTLFSILLGLSGIQVILCL
FT                   IQIINGLIGGICGVWCCQDSQQSYAC"
     LILAIFCIAA NILLFFPNGE TQYASQNHLS RFVWFFHGIG GAGLLMLLPA GVFIGLENED        60
     CCGCCGNERC GKSCAMLSSI LAALIGVAGA GYCVVISALG LAEGPLCLNN NQWSYAFEST       120
     NGKYLTDYQS WSTCTEPRNV VVWNVTLFSI LLGLSGIQVI LCLIQIINGL IGGICGVWCC       180
     QDSQQSYAC                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page