(data stored in ACNUC7421 zone)

EMBL: BC171148.PE1

BC171148.PE1         Location/Qualifiers
FT   CDS             88..972
FT                   /codon_start=1
FT                   /gene="LOC100135206"
FT                   /product="hypothetical protein LOC100135206"
FT                   /db_xref="GOA:B7ZU88"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZU88"
FT                   /protein_id="AAI71148.1"
FT                   /translation="MGSLVRLLVGVQRALPGSVWAVRRLSSGASEVYAARLDGSNEGIA
FT                   EIIMSRPHARNSLGKVFVSEFFDTVDNLRHDSSVRVVVVKSSIPGIFCAGADLKERAQM
FT                   DNAEVSLFVQQLRKLMSEIAALPMPTIAAVDGFALGGGLELALACDLRVAASSAKMGLI
FT                   ETTRGLLPGAGGSQRLPRLLGIGLAKELIFTGRQIDGTEAQHIGLVNDAVPQNEEGDAA
FT                   YLRALELAQEILPQAPVAVRMAKLAMNRGIEVDIASGMAIEAMCYGQVIPTKDRLEGMS
FT                   AFREKRQPHYTGK"
     MGSLVRLLVG VQRALPGSVW AVRRLSSGAS EVYAARLDGS NEGIAEIIMS RPHARNSLGK        60
     VFVSEFFDTV DNLRHDSSVR VVVVKSSIPG IFCAGADLKE RAQMDNAEVS LFVQQLRKLM       120
     SEIAALPMPT IAAVDGFALG GGLELALACD LRVAASSAKM GLIETTRGLL PGAGGSQRLP       180
     RLLGIGLAKE LIFTGRQIDG TEAQHIGLVN DAVPQNEEGD AAYLRALELA QEILPQAPVA       240
     VRMAKLAMNR GIEVDIASGM AIEAMCYGQV IPTKDRLEGM SAFREKRQPH YTGK             294
//

If you have problems or comments...

PBIL Back to PBIL home page