(data stored in ACNUC7421 zone)

EMBL: BC172016.DDX3X

BC172016.DDX3X       Location/Qualifiers
FT   CDS             46..2031
FT                   /codon_start=1
FT                   /gene="Ddx3x"
FT                   /product="Ddx3x protein"
FT                   /db_xref="GOA:B7ZWF1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:103064"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZWF1"
FT                   /protein_id="AAI72016.1"
FT                   /translation="MSHVAVENALGLDQQFAGLDLNSSDNQSGGSTASRRYIPPHLRNR
FT                   EATKGFYDKDSSGWSSSKDKDAYSSFGSRGDSRGKSSFFGDRGSGSRGRFDDRGRGDYD
FT                   GIGGRGDRSGFGKFERGGNSRWCDKSDEDDWSKPLPPSERLEQELFSGGNTGINFEKYD
FT                   DIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMAC
FT                   AQTGSGKTAAFLLPILSQIYADGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQI
FT                   YEEARKFSYRSRVRPCVVYGGAEIGQQIRDLERGCHLLVATPGRLVDMMERGKIGLDFC
FT                   KYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEY
FT                   IFLAVGRVGSTSENITQKVVWVEEIDKRSFLLDLLNATGKDSLTLVFVETKKGADSLED
FT                   FLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDL
FT                   PSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAFE
FT                   HHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGGSRGFGG
FT                   GGYGGFYNSDGYGGNYNSQGVDWWGN"
     MSHVAVENAL GLDQQFAGLD LNSSDNQSGG STASRRYIPP HLRNREATKG FYDKDSSGWS        60
     SSKDKDAYSS FGSRGDSRGK SSFFGDRGSG SRGRFDDRGR GDYDGIGGRG DRSGFGKFER       120
     GGNSRWCDKS DEDDWSKPLP PSERLEQELF SGGNTGINFE KYDDIPVEAT GNNCPPHIES       180
     FSDVEMGEII MGNIELTRYT RPTPVQKHAI PIIKEKRDLM ACAQTGSGKT AAFLLPILSQ       240
     IYADGPGEAL RAMKENGRYG RRKQYPISLV LAPTRELAVQ IYEEARKFSY RSRVRPCVVY       300
     GGAEIGQQIR DLERGCHLLV ATPGRLVDMM ERGKIGLDFC KYLVLDEADR MLDMGFEPQI       360
     RRIVEQDTMP PKGVRHTMMF SATFPKEIQM LARDFLDEYI FLAVGRVGST SENITQKVVW       420
     VEEIDKRSFL LDLLNATGKD SLTLVFVETK KGADSLEDFL YHEGYACTSI HGDRSQRDRE       480
     EALHQFRSGK SPILVATAVA ARGLDISNVK HVINFDLPSD IEEYVHRIGR TGRVGNLGLA       540
     TSFFNERNIN ITKDLLDLLV EAKQEVPSWL ENMAFEHHYK GSSRGRSKSS RFSGGFGARD       600
     YRQSSGASSS SFSSSRASSS RSGGGGHGGS RGFGGGGYGG FYNSDGYGGN YNSQGVDWWG       660
     N                                                                       661
//

If you have problems or comments...

PBIL Back to PBIL home page