(data stored in ACNUC16935 zone)

EMBL: BN001307.CSND

BN001307.CSND        Location/Qualifiers
FT   CDS             1051281..1052507
FT                   /gene="csnD"
FT                   /locus_tag="ANIA_01539"
FT                   /old_locus_tag="AN1539.4"
FT                   /product="COP9 signalosome complex subunit 4 (Signalosome
FT                   subunit 4) [Source:UniProtKB/Swiss-Prot;Acc:Q9C467]"
FT                   /note="transcript_id=CADANIAT00008166"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008166"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008166"
FT                   /db_xref="GOA:Q9C467"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037754"
FT                   /db_xref="InterPro:IPR040134"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C467"
FT                   /protein_id="CBF85069.1"
FT                   /translation="MPSQKIISALAEIESSASPQNKLQLYNDLLSETVSASPEPQLADD
FT                   LIYYLDSVLSEDLSIVAARPILDSFIYTLRKLSSETQIKVAQHAVNLLQSRSASVEEQD
FT                   AQIREILADAYEAEEEYIAAARALQGIHIDSSQRLVSDSAKVKLWIRIVRLYLEEDDTT
FT                   SAEAFLNRIKNLPSKIEDHELKLHFRLSQARIQDARRRFLDASQEYFAVSLAAGVDESD
FT                   RLQALAAAIRCAVLAPAGPQRSRTLATLYKDDRATSVEEFGILEKMFLDRLLTPEEVSA
FT                   FAQRLAPHQLAQTADGTTVLDKAVVEHNLVAASKLYENIKTDALGAILGLQASGDLTAG
FT                   EKAEAYAARMVEQGRLSGSIDQIDGIIYFESNTTATGRHIRQWDAGVQGLSEGVERVAT
FT                   NIAEGHLVR"
     MPSQKIISAL AEIESSASPQ NKLQLYNDLL SETVSASPEP QLADDLIYYL DSVLSEDLSI        60
     VAARPILDSF IYTLRKLSSE TQIKVAQHAV NLLQSRSASV EEQDAQIREI LADAYEAEEE       120
     YIAAARALQG IHIDSSQRLV SDSAKVKLWI RIVRLYLEED DTTSAEAFLN RIKNLPSKIE       180
     DHELKLHFRL SQARIQDARR RFLDASQEYF AVSLAAGVDE SDRLQALAAA IRCAVLAPAG       240
     PQRSRTLATL YKDDRATSVE EFGILEKMFL DRLLTPEEVS AFAQRLAPHQ LAQTADGTTV       300
     LDKAVVEHNL VAASKLYENI KTDALGAILG LQASGDLTAG EKAEAYAARM VEQGRLSGSI       360
     DQIDGIIYFE SNTTATGRHI RQWDAGVQGL SEGVERVATN IAEGHLVR                    408
//

If you have problems or comments...

PBIL Back to PBIL home page