(data stored in ACNUC16935 zone)

EMBL: BN001307.FPHA

BN001307.FPHA        Location/Qualifiers
FT   CDS             complement(join(141411..141704,141761..145309))
FT                   /gene="fphA"
FT                   /locus_tag="ANIA_09008"
FT                   /old_locus_tag="AN9008.4"
FT                   /product="PhytochromePutative uncharacterized protein ;
FT                   [Source:UniProtKB/TrEMBL;Acc:Q5K039]"
FT                   /note="transcript_id=CADANIAT00007846"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007846"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007846"
FT                   /db_xref="GOA:G5EB62"
FT                   /db_xref="InterPro:IPR001294"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013515"
FT                   /db_xref="InterPro:IPR013654"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:G5EB62"
FT                   /protein_id="CBF84471.1"
FT                   /translation="MSELPSRSISPRDPSPGETPGRDPSTPSTDAGVGYSASQDAPSFG
FT                   AYDRVYPIRSLVSLEPPATSEPSSNKSKSPLSPTSGARQFSIIDGHTWTRLRSDSRANS
FT                   TDYSGGTGLSPESSEAPSSQRMSDSSSARPPSNTTGLRRGDDHTTFTPSSEDSHPQVQE
FT                   PYELMTTRFRHVVTDDGHAVITGRTVDSFKACEDEPIHIPGAIQSFGALVAVREEPGEQ
FT                   MVVRIVSENSQDILGYSPNDLFSLPTLCDIFPEDQADNFLDHVDFVKEEGYDPSVDGPE
FT                   VFILTVNQPNGSTIRVWCAIHTNPALNGLVICEFELEDDHVNPLTSSGHISPAVPTNTL
FT                   DVVPTIEQMAGSTITINQPLRVLRRARRRKGEAAAMEVFSIVSQIQEQLARADNMEALL
FT                   DTTSGIVKELTGFHRILVYQFDSEFNGKVVSELVDPTMSIDLFKGLHFPAADIPKQARD
FT                   LYRINKVRLLYDRDHVTARLVCRALEDLETPLDMTHAYLRAMSPIHIKYLANMQIRSSM
FT                   SISINSMNDLWGLISCHSYGPRGMRVSFPIRKMCRLIGDTVSRNIERLSYASRLQARKL
FT                   INTVPTDANPSGYIVASSDDLLRLVDADYGALCIRGEVKILAKSPQSQEMLALLEYLKV
FT                   RKYNSVLTSNHIVKDFQDLNYPPGFKDISGLLYVPLSTDGLDFIVFFRRGQLTEVKWGG
FT                   NPNEAKFTEGHLEPRKSFQTWRETVLDRCRDWTESEVDTAAVLCLVYGKFIKVWRQQEA
FT                   ALESSSLTKLLLANSAHEVRTPLNAIVNYLEIALEGALDGETRDHLSKSYSASKSLIYV
FT                   INDLLDLTNVEKGQSLIKDEPFDLPTTFSEATAMFESEAKRKGLNYKVLSQPGIPETVI
FT                   GDQRRVRQSISNLISNAVQNTSSGGVTVEVWHAPGEGDTDKATVKIAVLDTGRGISSST
FT                   LELLFRELEQVSGEDDSHYYGGSEEGEESAPEAKASKDKAVLGLGLALVARIVRNMHGQ
FT                   LTVRSEEGKGSRFQISLQFPIPEGSDTKSPTAEHRPVATGDSAAPFSTGDDVILVDSTT
FT                   GSKRNSQDSLTRPDVPRKSEPEDTAPADGAGEQASGESEAQTRPKKTGESTASTSHEQS
FT                   ETARSRPSGPSSGPSAPERRPLRVLVAEDDPINAKIIEKRLEKLGHTVQRTVNGEECAN
FT                   AYSAESTQWDVVLMDIQMPILDGIESTKRIRQHESQSEVANLHIPIFAVSASLLEKDVQ
FT                   MYMDIGFDGWIMKPINFVRLNTLLAGIHEERARNGAVYQPGQWEKGGWFTPYTHS"
     MSELPSRSIS PRDPSPGETP GRDPSTPSTD AGVGYSASQD APSFGAYDRV YPIRSLVSLE        60
     PPATSEPSSN KSKSPLSPTS GARQFSIIDG HTWTRLRSDS RANSTDYSGG TGLSPESSEA       120
     PSSQRMSDSS SARPPSNTTG LRRGDDHTTF TPSSEDSHPQ VQEPYELMTT RFRHVVTDDG       180
     HAVITGRTVD SFKACEDEPI HIPGAIQSFG ALVAVREEPG EQMVVRIVSE NSQDILGYSP       240
     NDLFSLPTLC DIFPEDQADN FLDHVDFVKE EGYDPSVDGP EVFILTVNQP NGSTIRVWCA       300
     IHTNPALNGL VICEFELEDD HVNPLTSSGH ISPAVPTNTL DVVPTIEQMA GSTITINQPL       360
     RVLRRARRRK GEAAAMEVFS IVSQIQEQLA RADNMEALLD TTSGIVKELT GFHRILVYQF       420
     DSEFNGKVVS ELVDPTMSID LFKGLHFPAA DIPKQARDLY RINKVRLLYD RDHVTARLVC       480
     RALEDLETPL DMTHAYLRAM SPIHIKYLAN MQIRSSMSIS INSMNDLWGL ISCHSYGPRG       540
     MRVSFPIRKM CRLIGDTVSR NIERLSYASR LQARKLINTV PTDANPSGYI VASSDDLLRL       600
     VDADYGALCI RGEVKILAKS PQSQEMLALL EYLKVRKYNS VLTSNHIVKD FQDLNYPPGF       660
     KDISGLLYVP LSTDGLDFIV FFRRGQLTEV KWGGNPNEAK FTEGHLEPRK SFQTWRETVL       720
     DRCRDWTESE VDTAAVLCLV YGKFIKVWRQ QEAALESSSL TKLLLANSAH EVRTPLNAIV       780
     NYLEIALEGA LDGETRDHLS KSYSASKSLI YVINDLLDLT NVEKGQSLIK DEPFDLPTTF       840
     SEATAMFESE AKRKGLNYKV LSQPGIPETV IGDQRRVRQS ISNLISNAVQ NTSSGGVTVE       900
     VWHAPGEGDT DKATVKIAVL DTGRGISSST LELLFRELEQ VSGEDDSHYY GGSEEGEESA       960
     PEAKASKDKA VLGLGLALVA RIVRNMHGQL TVRSEEGKGS RFQISLQFPI PEGSDTKSPT      1020
     AEHRPVATGD SAAPFSTGDD VILVDSTTGS KRNSQDSLTR PDVPRKSEPE DTAPADGAGE      1080
     QASGESEAQT RPKKTGESTA STSHEQSETA RSRPSGPSSG PSAPERRPLR VLVAEDDPIN      1140
     AKIIEKRLEK LGHTVQRTVN GEECANAYSA ESTQWDVVLM DIQMPILDGI ESTKRIRQHE      1200
     SQSEVANLHI PIFAVSASLL EKDVQMYMDI GFDGWIMKPI NFVRLNTLLA GIHEERARNG      1260
     AVYQPGQWEK GGWFTPYTHS                                                  1280
//

If you have problems or comments...

PBIL Back to PBIL home page