(data stored in ACNUC16935 zone)

EMBL: BN001307.PE10

BN001307.PE10        Location/Qualifiers
FT   CDS             complement(join(34123..34165,34216..35243))
FT                   /locus_tag="ANIA_09051"
FT                   /old_locus_tag="AN9051.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007802"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007802"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007802"
FT                   /db_xref="GOA:Q5ARM9"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARM9"
FT                   /protein_id="CBF84388.1"
FT                   /translation="MSIPTRALGRNGPEVSSVGLGLMSIGGIYGAAPSDEDRLALLDRA
FT                   HAIGQWFWDTADVYFDSEDIVGIWRAKNPIKAKDIFLASKFGITMRKDGSQTVDTSPEY
FT                   ARIALKRSLERLQTGTIDLYYAHRVDGKTPIEKTVEAMAQFKKSSRLPLVFSRTNTNYR
FT                   EGKIRFLGLSEVSADTLRRAHAVHPITAVQVEYSPFTLDIEDPRVALLETCRELGVAVV
FT                   AYSPVGRGLLTGRYVTRESITKDFFLSVLPRYSEENFPAIQRLYESIKDVAEKKGVTPT
FT                   QATLAWLLAREPFVIPIPGTRSIKYLVENTASAQIQLTDDENRRITEAANATKLVGARY
FT                   PAGFPENYEFGTTPEL"
     MSIPTRALGR NGPEVSSVGL GLMSIGGIYG AAPSDEDRLA LLDRAHAIGQ WFWDTADVYF        60
     DSEDIVGIWR AKNPIKAKDI FLASKFGITM RKDGSQTVDT SPEYARIALK RSLERLQTGT       120
     IDLYYAHRVD GKTPIEKTVE AMAQFKKSSR LPLVFSRTNT NYREGKIRFL GLSEVSADTL       180
     RRAHAVHPIT AVQVEYSPFT LDIEDPRVAL LETCRELGVA VVAYSPVGRG LLTGRYVTRE       240
     SITKDFFLSV LPRYSEENFP AIQRLYESIK DVAEKKGVTP TQATLAWLLA REPFVIPIPG       300
     TRSIKYLVEN TASAQIQLTD DENRRITEAA NATKLVGARY PAGFPENYEF GTTPEL           356
//

If you have problems or comments...

PBIL Back to PBIL home page