(data stored in ACNUC16935 zone)

EMBL: BN001307.PE100

BN001307.PE100       Location/Qualifiers
FT   CDS             join(272267..272303,272444..273468)
FT                   /locus_tag="ANIA_11156"
FT                   /old_locus_tag="AN11156.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007891"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007891"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007891"
FT                   /db_xref="GOA:C8VL88"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C8VL88"
FT                   /protein_id="CBF84554.1"
FT                   /translation="MNILPRHAIATREQIFSASSPIPSGLLPQLKLPEGRNNAKNSLPT
FT                   RARHECPHIQVSDWYLPFASSIYCNPFSRAQFIIILLYSTNPPHRTASFRRTLPHSYVF
FT                   DFISGPFPSSPAPGIKAIYPDSPTYTWFREPTPAGLRAAHRYVAEYIQKHGPYDAVMGF
FT                   SQGCSLIASMALYHSYDRLSEQGQNGIRGDLPFKAAIFICGGIPLYALQDMGIPVSEEA
FT                   ETISKITGQLLNTTATKLSTFASNTSLIKRGVGLWDNNVTSNTLVHDPSVRPPRNDLFG
FT                   LDFTSFPSWAKIDIPTVHVYGGKDPRWPAGIQLAEFCADRVEFDHEGGHDIPRGSVVSE
FT                   RIGGMIQDLLRRV"
     MNILPRHAIA TREQIFSASS PIPSGLLPQL KLPEGRNNAK NSLPTRARHE CPHIQVSDWY        60
     LPFASSIYCN PFSRAQFIII LLYSTNPPHR TASFRRTLPH SYVFDFISGP FPSSPAPGIK       120
     AIYPDSPTYT WFREPTPAGL RAAHRYVAEY IQKHGPYDAV MGFSQGCSLI ASMALYHSYD       180
     RLSEQGQNGI RGDLPFKAAI FICGGIPLYA LQDMGIPVSE EAETISKITG QLLNTTATKL       240
     STFASNTSLI KRGVGLWDNN VTSNTLVHDP SVRPPRNDLF GLDFTSFPSW AKIDIPTVHV       300
     YGGKDPRWPA GIQLAEFCAD RVEFDHEGGH DIPRGSVVSE RIGGMIQDLL RRV              353
//

If you have problems or comments...

PBIL Back to PBIL home page