(data stored in ACNUC16935 zone)

EMBL: BN001307.PE101

BN001307.PE101       Location/Qualifiers
FT   CDS             join(273684..273794,273854..274495)
FT                   /locus_tag="ANIA_11157"
FT                   /old_locus_tag="AN11157.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007892"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007892"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007892"
FT                   /db_xref="GOA:C8VL89"
FT                   /db_xref="UniProtKB/TrEMBL:C8VL89"
FT                   /protein_id="CBF84555.1"
FT                   /translation="MPQNAKNYTDPELREQVKNEVQQGDKGGKPGQWSARKAQMTASEY
FT                   KARGGDYTTSKDEKKSEQKHLDKWTNEEWQTKEGSGTAKQDDGTRKRYLPKKAWEELDE
FT                   REKKATEQKKLEGSKAGKQFVANTGEAKRKRGEVSREGEKKGSRNGGKDKKGGQVDRKK
FT                   EKEGKMKQEPEENGENGENEEEEVENTENDEDYERDGEDLDGENEESGDNSGSEDEDEE
FT                   QNQQADEKETETDTPEGEQPEKKRQKQD"
     MPQNAKNYTD PELREQVKNE VQQGDKGGKP GQWSARKAQM TASEYKARGG DYTTSKDEKK        60
     SEQKHLDKWT NEEWQTKEGS GTAKQDDGTR KRYLPKKAWE ELDEREKKAT EQKKLEGSKA       120
     GKQFVANTGE AKRKRGEVSR EGEKKGSRNG GKDKKGGQVD RKKEKEGKMK QEPEENGENG       180
     ENEEEEVENT ENDEDYERDG EDLDGENEES GDNSGSEDED EEQNQQADEK ETETDTPEGE       240
     QPEKKRQKQD                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page