(data stored in ACNUC16935 zone)

EMBL: BN001307.PE102

BN001307.PE102       Location/Qualifiers
FT   CDS             complement(join(276386..276429,276816..277246,
FT                   277298..277748,277813..277917,277973..278130,
FT                   278195..278418))
FT                   /locus_tag="ANIA_08964"
FT                   /old_locus_tag="AN8964.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007893"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007893"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007893"
FT                   /db_xref="GOA:Q5ARW6"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARW6"
FT                   /protein_id="CBF84557.1"
FT                   /translation="MDTREKALANLHAAGLSDILYLPSSDVYSARVESYWSLTAQLKPW
FT                   AIVRPRNTEEVSKAVKAIVATPDVKFAIRSGGHMQWPGANNIVNGITIDLGLMNSTTYD
FT                   PETGIASIQPGGTWAKSYQELEKQGRMVAGGREGKVGIGGLLTGGGKTFYTCRNGFACD
FT                   QVVNYELVLADGSISNANSTTNPDLFRALKGGGNNFGVVTRFDMTTFSAVDVWDCTITY
FT                   PKKATLQLSEAIVDLTKNLAAYPDDHILAMWTYLPKTEEHFVMVNMMNLEGVKEARTLE
FT                   KFLGIPEQMNRVDTTVSVATKLTSFVVPSGKYDTWYTTTFKADPQIILKSASVFESLVS
FT                   ALKNQVPYSNFYTQIVLQPLPVSFGAHSTARGGNMMGLDQMKVDCVLLVWAVEVDTPEL
FT                   NANVAGPTLKSAIEKIETYARSVKGDVGFRYLNYCDKEQDALGSYGEENVRHMKEVAVF
FT                   SEKVAEDVVRLS"
     MDTREKALAN LHAAGLSDIL YLPSSDVYSA RVESYWSLTA QLKPWAIVRP RNTEEVSKAV        60
     KAIVATPDVK FAIRSGGHMQ WPGANNIVNG ITIDLGLMNS TTYDPETGIA SIQPGGTWAK       120
     SYQELEKQGR MVAGGREGKV GIGGLLTGGG KTFYTCRNGF ACDQVVNYEL VLADGSISNA       180
     NSTTNPDLFR ALKGGGNNFG VVTRFDMTTF SAVDVWDCTI TYPKKATLQL SEAIVDLTKN       240
     LAAYPDDHIL AMWTYLPKTE EHFVMVNMMN LEGVKEARTL EKFLGIPEQM NRVDTTVSVA       300
     TKLTSFVVPS GKYDTWYTTT FKADPQIILK SASVFESLVS ALKNQVPYSN FYTQIVLQPL       360
     PVSFGAHSTA RGGNMMGLDQ MKVDCVLLVW AVEVDTPELN ANVAGPTLKS AIEKIETYAR       420
     SVKGDVGFRY LNYCDKEQDA LGSYGEENVR HMKEVAVFSE KVAEDVVRLS                  470
//

If you have problems or comments...

PBIL Back to PBIL home page